Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC155610.2-GRMZM2G034360
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):transferase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.59709742016706
Log2 mRNA fold difference:1.0382326036748
Log2 TE fold difference:-0.38025892065298
Sequences
Protein sequence

MVADMKENGGAVLAAGEKAPQVVVKRGEPTLVPPAEATPTGGQYYLSNLDQNIAVIVQTV
YCYKPSGGGGDVAAALRGALARVLVHYYPLAGRLGVSPEMKLTVELTGEGAVFVEADAAC
ELATVGDLTKPDPAALGQLVYSVPGAKHILEMPPMTAQVTRFKCGGFALGLAMNHCMFDG
IGAMEFVNSWAETARGVAELTVPPFLDRGVLKARDPPVHTFPHHEFAEIPDVSDTAALYG
AQELQYRSFCFDPDRLERVRGLALADGALGRCTTFEALSGLVWRARTKALGLAPGQRTKL
LFAVDGRRRFVPPLPRGYFGNGIVLTNALATAGELLSAPVSRAAGLVQEAVRMVTDDYMR
SAVDYFEATRARPSLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAHGK
ERKSINVLLGLPATAMDAFQELVDEI*

MVVEMKENGGAALAAGEKAPQLGVKRGEPTLVPPAEATPTGGQYYLSNLDQNIAVIVQTV
YCYKPSSPGGGEGKEDVDVAGALRDALARVLVHYHPLAGRLGVSPEMKLTVELTGEGAVF
VEADAACDLDAVGDLTKPDPAALGQLVYSVPGAKHILEMPPMTAQVTRFKCGGFALGLAM
NHCMFDGIGAMEFVNSWAETARGVAELTVPPFLDRSVLKARDPPVPTFPHHEFAEIPDVS
DTAALYGAQELLYRSFCFDPDRLERVRGLALADGALGRCTTFEALSGLVWRARTRALGLA
PEQRTKLLFAVDGRRRFAPPLPRGYFGNGIVLTNALATAGELLSAPVSRAAGLVQDAVRM
VTDDYMRSAVDYFEATRARPSLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVI
LFLAHGKERKSINVLLGLPATAMDAFQELMDEI*

Other information
Ka divergence:-0.628641KaKs divergence:-0.806519
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1341Length 2 (bp):1362Length divergence:0.008
MFE 1 (kcal):-707.52MFE 2 (kcal):-718.7MFE divergence0.008