Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC186606.4-GRMZM2G144480
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.9739963236114
Log2 mRNA fold difference:0.17177341516348
Log2 TE fold difference:0
Sequences
Protein sequence

MYHHHFHGEVASLRFLSPPNVSTSFAAHHHMNMALPPPSYFQDDDATLAAIDGGDAACFD
ELDTIVVVPEADAAAAARCHLTGSNNGGLSDSDQLLDAAVIMAADEERRRRRMVSNRESA
RRSRMRKQRQLSELWAQVSHLRGANRRLLDDLNRALRSCADARRESARLREEKAELTKKL
EQLLQAEKGSLSEAAEPCKSYC*

MYHHHFHGEVDSLRFLSPPTTASFAAAHHQHMNMPLPPPAYYLAIDGDAACFDELDTIVR
EAAAHLGGNSNNESPSLSGSGSDSAAAADQERRRRRMVSNRESARRSRVRKQRQLSELWA
QVSHLRGANRRLLDDLNRALRSCADARRENARLRDEKAQLANRLHQLLIIAG*

Other information
Ka divergence:-0.0862339KaKs divergence:0.0963855
GC content 1 (%):66GC content 2 (%):69GC content divergence:0.022
Length 1 (bp):609Length 2 (bp):519Length divergence:-0.08
MFE 1 (kcal):-292.13MFE 2 (kcal):-238.9MFE divergence-0.1