Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC187098.4-GRMZM2G140970
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.19737944311472
Log2 mRNA fold difference:-0.26605937028797
Log2 TE fold difference:0.063530107056585
Sequences
Protein sequence

MSARIDLNNNAGSASQTLAAHKRGRGRPRKNPPPPAHPRPPHPDTPMVSGFAPGDMVWGK
KLNHAAWPGLIYSAGGNGTGHEGQLLVSYFGDKAFAWCDTAELRPYEPYFPVAELYDDGG
EDFDAAVEASLDEFSSRVESALASAARPFAPADFLASLHDLAADRMGFTNRVQAAVVKAH
LRAFDAFRALPDPPQYTLELGLLPDVPLPLPNPKAATDAAFSSYTTPASSFRRGRKRKEE
LIKDDDSDEDWDPSKRGATDLDSDVDFDCRRGSRGRGRGGGGTGASRGRPRGRPRKADAC
MDEDEIQDKLEYPSAAEMLLQLLSIATDPVNGNYDSAPVIVSFFSKHKDSDVPSLYEDKE
LIENFGGKKGKKKSIGSLGPATKPEASDDTVDGQRGRRKSAGSLYSARKAEDSYWCDIII
SDFDDGDSDYDSHKRKRPCNRSTNKKMKQEEPPQGAPSSNAKPADGPAALILHFSSPEAI
PSVDDINSIFRIHGPIVERETVITKKSKIAKVVFSKSVDAEQAHHSSGKRNAFGPSLLTS
EIKYLPSAPQVS*

MSERIDLNNTSQTLAPPKRGRGRPRKNPPPPAHPRPPDPDTPMVSGFAPGDMVWGKKLNH
AAWPGLIYSAGGNSTGHEAQLLVSYFGDKAFAWCDAAELRPYEPYFPVAELYDDGGEDFD
AAVEASLDEFSRRVEAALASAARPFASADFLASLHDLAADRMGFTNRVQAAVAKAHLRAF
DAFRALPDPPQYTLELGLLPHVPLPLPDPKADTDAAAAFTTPASSSRRGRKRKEELVKDD
DSDEDWDPSKRGATDLDSDVDFDHRRGSRGRGRGRGGSSGGSGRPRGRPRKTDACRDAPQ
LKDEDGIQEYPSADEMLLQLLSIATDPVNGNYDSAPVIVSFFSKHKDSKAPSVYEDKELL
ENFGCKKGRKKPVRSLGLAPKPEASDDKDQFMTVDGQRGRRKSAGSLYSARKAEDSYWCD
IIISDFDDGDSDYEGCKRKRPSQNTNRSANKKMKQEEPPQGAPSDMENGAPADPSSNEKP
ADGPAALILHFSSPEAIPSVDDINSIFRIHGPIVERETVITKKSKIAKVVFSKSADAESA
YHSSGKHNAFGPSLLTSEIKYLPSEPQAS*

Other information
Ka divergence:-0.0597252KaKs divergence:-0.0574294
GC content 1 (%):57GC content 2 (%):58GC content divergence:0.009
Length 1 (bp):1659Length 2 (bp):1710Length divergence:0.015
MFE 1 (kcal):-621.24MFE 2 (kcal):-669.49MFE divergence0.037