Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC188838.3-GRMZM2G018238
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.68710502005346
Log2 mRNA fold difference:1.5966315467146
Log2 TE fold difference:-1.739093572884
Sequences
Protein sequence

MGIVAAAAATTATSRLLYRYAAAGSDRHNRHHLRYYASPYPLSLRCGSGRREAAARALLP
DRVTPFSYGVDEDADDHPREECGVIGVVGDPDASSLCYLGLQKLQHRGEEGAGIVAVGGD
GKLKSVTGLGLVADVFADPSRLASLPGPAAIGHVRYSTAGAAASLRNVQPFLAGYRFGQV
AVAHNGNLVNYQALRNKLEARGSIFNTSSDTEVILHLIATSLSRPLLARVCDACERLAGA
YSLLFLTADKLFAVRDPHGFRPLVMGRRRNGAVVFASETCALDLIDATYEREVEPGEVVV
VDRRDMSVASACLVPHRPRRACVFEHIYFSLPNSVVFSHAVHERRTAFGQALAEESPAPG
ADVVIPVPDSGFYAALGFARASGLEFQQGLIRWHYSGRSFIQPTQAIRDLAVKLKLAPVR
GVITGKSVVVVDDSLVRGTTSSKIVRLLRDAGAREVHMRIASPPVVGSCLYGIDTPSEGE
LISNRMDLDGVRREIGSDSLAFLSLDKLHSIYGEESGNYCDACFSRKYPVLPTLADPAAE
LED*

MGIVAAATTAAATCTSRLLHHHATYHRHQLRYSASPFPLSLHCGSGRREAAARALLPDRV
TPFSYGVDEDADDHPREECGLVGVVGDPDASSLCYLGLQKLQHRGEEGAGIVAVGGDGKL
KSVTGLGLVADVFGDPSRLASLPGPAAIGHVRYSTAGAAASLRNVQPFLAGYRFGQVAVA
HNGNLVNYQALRNKLEARGSIFNTSSDTEVILHLIATSLSRPLLARVCDACERLAGSYSL
LFLTADKLFAVRDPHGFRPLVMGRRRNGAVVFASETCALDLIDATYEREVEPGEVVMVDR
RDMSVASACLLPHRPRRACVFEHIYFSLPNSVVFSHAVHERRTAFGQALAEESPAPGADV
VIPVPDSGFYAALGFARASGLEFQQGLIRWHYSGRSFIQPTQAIRDLAVKLKLAPVRGVI
TGKSVVVVDDSLVRGTTSSKIVRLLRDAGAREVHMRIASPPVVGSCLYGIDTPSEGELIS
NRMDMDGVRREIGSDSLAFLSLGKLHSIYGEESRDYCDACFSRKYPVLPTLADPAAEPEE
*

Other information
Ka divergence:-0.136986KaKs divergence:-0.13059
GC content 1 (%):70GC content 2 (%):69GC content divergence:-0.007
Length 1 (bp):1632Length 2 (bp):1623Length divergence:-0.003
MFE 1 (kcal):-824.2MFE 2 (kcal):-807.9MFE divergence-0.01