Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC189750.4-GRMZM2G087254
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):adenosine 5'-phosphosulfate reductase 2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.444041236763
Log2 mRNA fold difference:-1.3213716933898
Log2 TE fold difference:-0.072244774535676
Sequences
Protein sequence

MASATTSISSHPAALRDVKGDMFSLFWMLFPLYNFCSDPTFQLVKCAAPQQNSPEFEAHT
GLTLLISLPSVRAAARIGGLRQQQASVAPSAAAARGQRARAVRSLRAAEPARQPVAASAA
AAAPAAPVADEAAALAAVDYEALARELEGASPLEIMDRALAMFGSEIAIAFSGAEDVALI
EYAKLTGRPFRVFSLDTGRLNPETYQLFDKVEKHYGIRIEYMFPDASEVQELVRTKGLFS
FYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRASIPLVQVDPSFEGLDGGA
GSLVKWNPVANVDGKDIWTFLRTMDVPVNTLHAQGYVSIGCEPCTRPVLPGQHEREGRWW
WEDAKAKECGLHKGNIDKDAQAAAPRSANGNGSAGAPDIFESPAVVSLTRTGIENLLRLE
NRAEPWLVVLYAPWCPFCQAMEASYVELAEKLAGSGVKVAKFRADGEQKPFAQAELQLQS
FPTVLLFPGRTARPIKYPSEKRDVDSLLAFVNSLR*

MASATTSISSHPAALRDVKAARIGGALRQVGVAARGQRARAVPPLRAAEPARRPVAASAA
AAPPAAPVADEAAVDYEALARELEGASPLEIMDRALAMFGSEIAIAFSGAEDVALIEYAK
LTGRPFRVFSLDTGRLNPETYQLFDRVEKHYGIRIEYMFPDASEVQELVRTKGLFSFYED
GHQECCRVRKVRPLRRALRGLRAWITGQRKDQSPGTRASIPLVQVDPSFEGLDGGAGSLV
KWNPVANVDGKDIWTFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDA
KAKECGLHKGNIDKDGQAAAAAAAPRTANGNGSAGAPDIFESPAVVSLTRAGVENLLRLE
SRAEPWLVVLYAPWCPFCQAMEASYVELAERLAGSGGVKVARFRADGEQKPFAQAELQLQ
SFPTVLLFPSRTARPIKYPSEKRDVDSLLAFVNSLR*

Other information
Ka divergence:0.420573KaKs divergence:0.00125471
GC content 1 (%):67GC content 2 (%):71GC content divergence:0.029
Length 1 (bp):1548Length 2 (bp):1371Length divergence:-0.061
MFE 1 (kcal):-759.3MFE 2 (kcal):-721.67MFE divergence-0.025