Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC190750.2-GRMZM2G034748
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.89243800487149
Log2 mRNA fold difference:0.46484039721574
Log2 TE fold difference:0.43592495984631
Sequences
Protein sequence

MAKQKEGVDKRTARKMIRSTEGCAKSITFERNNKSDAVQLHDLPNDILGSILSRLTFRES
SQMGLVSHTWRRLWRSCCRKLVFTSATMFQPGNRSIKHTRTNFAMRVNSFLRQLHTHPTL
NKFVIKFGLRRKHTRHVNRWIRFCSVSRARHITINFTPGVKDFFMGPANSKYIFPLNVFS
GPEGSSTHVRTLHLGYVCLDTTSSDFMIFANLKKLTLHKISFLGDLQCLMLPECNSLECL
SISFCSLPGLSTCQPLQRLRCVRLHYCYLKKIELEAPNLTSFDLTNQPIPFVLGGSLNVM
EANIKLLAKDSPYGDNLDYIYTELPAALSHVHKLSITSGLFVFDQLQGFSKTSARFINLR
HLTMYLPLYGEPKSISGILRLAYLLELAPALEELELHVNGGDVDVGWALRGNMLPYSHNR
LKRVLISGASVWEGLMELAYYIFRSANRLESMVLDPKIRIGAPQLDGWMIDIGRETIKKL
FEGEEFQSIITIL*

MAKQKEGVDKRTARKMIRSTEGCAKSITFERNNKSDAVQLHDLPNDILGSILSRLTFRAS
SQMGLVSHTWRRLWRSCCRKLVFTGATMFQPGNRSIKHTRTNFAMRVNSFLRQLRTHPTL
NKFVIKFGLRRKHTRHVNRWIRFCSVSRARHITINFTPGVKDFVMGPANSKYIFPLNVFS
GPEGSSTHVRTLHLGYVCLDTTSSDFMIFANLKKLTLHKISFLGDLQCLMLPECNSLECL
SISFCSLPGLSTCHPLQRLRCVRLHYCYLKKIELEAPNLTSFDLTNQPIPFVLGGPLKLM
EANIKLLAKDSPYGDNLDYIYTELPAALSHVHKLSITSDLFIYDQLQGFSKTSARFINLR
HLTMYLPLYGEPKSISGILRLAYLLELAPALEELELHVSGLLTL*

Other information
Ka divergence:0.467116KaKs divergence:-0.992389
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1482Length 2 (bp):1215Length divergence:-0.099
MFE 1 (kcal):-465.79MFE 2 (kcal):-366.93MFE divergence-0.119