Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC194914.3-GRMZM2G134731
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382238 (LOC100382238), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.8309851258464
Log2 mRNA fold difference:-2.2955561337055
Log2 TE fold difference:-0.56788360123533
Sequences
Protein sequence

MDQQGAGGDAEVPAGLGLTAAEYEQLRSTVDAHHRYAVGEGQCSSLLAQRIHAPPEAVWA
VVRRFDCPQVYKHFIRSCALRPDPEAGDALCPGRLREVSVISGLPASTSTERLDLLDDAA
RVFGFSITGGEHRLRNYRSVTTVSELADPAICTVVLESYVVDVPDGNTEDDTRLFADTVI
RLNLQKLKSVAEANAAEAAATTNSVLLPRPAE*

MDQQGAGGDVEVPAGLGLTAAEYEQLRPTVDAHHRYAVGEGQCSSLLAQRIHAPPAAVWA
IVRRFDCPQVYKHFIRSCAVRPDPDAGDALRPGRLREVCVISGLPASTSTERLDHLDDAA
RVFGFSITGGEHRLRNYRSVTTVSELAGPGICTVVLESYAVDVPDGNTEDDTRLFADTVI
RLNLQKLKSVAEASTSSSAPPPPSE*

Other information
Ka divergence:0.253974KaKs divergence:0.395735
GC content 1 (%):70GC content 2 (%):72GC content divergence:0.014
Length 1 (bp):639Length 2 (bp):618Length divergence:-0.017
MFE 1 (kcal):-301.4MFE 2 (kcal):-305.56MFE divergence0.007