Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC196156.3-GRMZM2G068575
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100276950

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-6.72586413381
Log2 mRNA fold difference:-4.371147016443
Log2 TE fold difference:-2.3642771165593
Sequences
Protein sequence

MGFIMDFAENMILRLMEDPDKRDQVRREHVYKMKERCERTKAAWSLPLRPYGFWTFDRFN
SQLSWDPQISQAAGRRDPYDDLIARHSGSPPSS*

MGFIMDFAENLILRLMEDPDKRDQVRREHVYKMKERCERTKAAWSLPLRPYGFWTFDRFN
SQLSWDPQISQAAGRRDPYDDLIARHSGSPPSS*

Other information
Ka divergence:-1KaKs divergence:-0.998621
GC content 1 (%):63GC content 2 (%):64GC content divergence:0.008
Length 1 (bp):282Length 2 (bp):282Length divergence:0
MFE 1 (kcal):-111MFE 2 (kcal):-112.2MFE divergence0.005