Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC197246.3-GRMZM2G155931
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):60S ribosomal protein L32 Fragment

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGDEPDGEAEEYLFKVVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMAIEGK
EVKAQIWDTAGQERFRAVTSAYYRGAFGALLVYDITRRSTFDNVGRWLQELNTHSDTTVA
KMLVGNKCDLGDIRQVPVEEGKALAEAEGLFFMETSALDATNVRTAFEIVIREIYSNVSR
KVLNSDSYKAELSLNRVSIDGDSKDEQKQGSRFGCC*

MAVPLLTKKIVKKRVKQFKRPHLDRYKCLKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKSTRHYLPNKFKKFVVHNVSELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDIVV
TNKLARLRSQEDE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):54GC content divergence:-0.085
Length 1 (bp):651Length 2 (bp):402Length divergence:-0.236
MFE 1 (kcal):-280.4MFE 2 (kcal):-143.5MFE divergence-0.323