Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC198418.3-GRMZM2G415491
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193526

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.8421508517127
Log2 mRNA fold difference:1.2348176057707
Log2 TE fold difference:0.59350051554984
Sequences
Protein sequence

MASLTLPALALALSNPGAVRLRAAAFRCWALRRRGWAAAGALASPNSVLSEHAFKRLQLG
SDDEDGEGPYGSDADEGFEAGEGDNEELAIARLGLPDELVATLEKRGITHLFPIQRAVLI
PALEGRDLIARAKTGTGKTLAFGIPMIKQLIEQDDGRITRRGRTPRVLVLAPTRELAKQV
EKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVQYL
VLDEADQMLAVGFEEDVETILQQLPAGRQSMLFSATMPSWVKKLSRRYLNNPLTIDLVGD
QDEKLAEGIKLYAIPLTTTSKRTVLSDLITVYAKGGKTIVFTRTKKDADEVSLALTNSIA
SEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVH
RSGRTGRAGKAGTAILMFTSSQKRTVKSLERDVGCNFEFISPPSIEEVLESSAEHVIATL
RGVHPESTKYFLGAAEKLTEELGPHALASALAHLSGFSQPPSSRSLISHEQGWVTLQLTR
EQGFGRGFFSPRSVTGFLSDVCSAAADEVGKIYLTADENVQGAVFDLPEEIAKDLLTMEL
PPGNTLTKISKLPALQDDGPATDSYGRFSNDRGSRNNRRSRGGGASRGRGGWDTDGEDRF
RRGGRSLRSDNDSWSDDDWSGGGRKSNRSSSFGSRSSSYSSRGSPSFGGRSSSFGGRESN
RSFSGACFNCGESGHRATDCPNK*

MASLVTLPAIAFSNPATASGAVRLRAAAFRCWALRRRGWAVAAAVASPNSVLSEHAFKRL
QLGSDDEDEEGPYGSDADEGFQGDEEELAIARLGLPDELVATLEKRGITHLFPIQRAVLI
PALGGRDLIARAKTGTGKTLAFGIPMIKQLMEQDDGRSTRRGRTPRVLVLAPTRELAKQV
EKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVQYL
VLDEADQMLAVGFEEDVETILQQLPADRQSMLFSATMPSWVKKLSRRYLNNPLTIDLVGD
QDEKLAEGIKLHAIPLTATSKRTILSDLITVYAKGGKTIVFTRTKKDADEVSLALTTSIA
SEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVH
RSGRTGRAGKAGTAILMFTSSQKRTVMSLERDVGCKFEFISPPSIEEVLESSAEHVIATL
RGVHPESTQYFLGAAEKLTEELGPHALASALAHLSGFSQPPSSRSLISYEQGWVTLQLTR
EPGYGRGFFSPRSVTGFLSDVCSAAADEVGKIYITADENVQGAVFDLPEEIAKDLLTMEV
PPGNTLTKISKLPALQDDSPATDSYGRFSNDRGSRNRRSRGGGASRGRGGWDTDSEDRYR
RGGRSLRSDNDSWSDDDWSGGGRKSNRSSSSFGGRSSSYGSRGSPSPSFGVRSSSLGGRE
SSRSFSGACFNCGESGHRASDCPNK*

Other information
Ka divergence:0.155133KaKs divergence:0.160025
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):2232Length 2 (bp):2238Length divergence:0.001
MFE 1 (kcal):-824.86MFE 2 (kcal):-834.7MFE divergence0.006