Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC198725.4-GRMZM2G029077
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100285218

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.695337935127
Log2 mRNA fold difference:2.3205902645287
Log2 TE fold difference:-0.77991174668738
Sequences
Protein sequence

MAVPGSDVATGCQLAAFLGGAIGVGVAASDARVRFDAEEEVRGVLPEARATAMQLSLRAS
TWSRRVWERSRSTPDVASGCGGLHEEKKSEVTDLKQQLRQLAGSRAPDADAQRRDVFKRV
ISCMTAGIDVSAAFGEMVLCSATSDVVTKKMCYLYVGAHARAHPDLALLTINFLQRDCQD
QDPTIRGLALRSLCSLRVPNLVEYLVTPLTTGLKDPSAYVRMIAAVGAAKLYHISATACI
DADLPASLKALMLSDPDAQVVANCLHALQEIWALEAAKSEAAAREIETLHSKPVVFYLLN
KIKEFSEWAQCIVLELASKFLPSDNNEIFDIMNLLEDRLQHANGAVVLATIKVFLHLTMS
MTDVHQQVHMLLPESWGRKGYGGAGVVAGAGGALCWGSGKPEMGSEGRESGGLALGDKGS
GGRWGGGSVGGRGHKGRGGGWRQCQGQGGRRSGHDGDAPIAGKAVGEFCDTGDVLVAAAA
PEVVGMVVVTGETEGWGGSSDILGSVYERIKAPLLTLVGAGSPEQSYSVLCHLHLLVMRA
PMLFSSDYKSFYCQFSDPSYVKKLKLEMLTAIANESNTYEIVTELCEYAGNVDVPIARES
IRAVGKIALQQYDVNAIVDRLLQFLEMDKDYVTAETLVLVKDLLRKYPQWSHDCIAVVGN
ISSKNIQEPKGKAALIWMLGEYSQDMHDAPYILENLVENWDEEHSPEVRLHLLTAVMKCF
FKRPPETQKALGATLSAGLSDTQQDVHDRALFYYRLLQYNPNVAERVVNPPKQAVSVFAD
TQSSETKDRIFDEFNSLSVVYQKPSYMFTDREHREPFEYSEDLTSLTVGAEDPENVISAQ
RYQENDNDLLLSTSDKEDNGTRASNGSSTSAYNAPSDLISPSLISSQTPAETSLVNTGGP
THSSQSNFSLDDLLGIGVTEAPAPTPPALTLNSKPVLDPGTFQRKWGQLALALSQECSLS
PQGAASLMNPQSLIRHMQSNYIQCIASGGQPPNYKFFFYAQKDGATAFFLVECIVNTASA
KAQLKIKADDGTAAEAFSTLFQSALSKFGLS*

MAPTVPSAAKSASPSQPSGKSEVADLKQQLRQLAGSRAPDADDQRRDVFKRVISCMTAGI
DVSAAFGEMVLCSATSDVVTKKMCYLYVGSHARAHPDLALLTINFLQRDCRDQDPTIRGL
ALRSLCSLRVPNLVEYLVTPLTTGLKDPSAYVRTIAAVGAAKLYHISATACIDADLPASL
KALMLSDPDAQVVANCLHALQEIWTLEAANSEAAAREIETLYSKPVVFYLLNKIKEFSEW
AQCIVLELASKFLPSDNNEIFDIMNLLEDRLQHANGAVVLATIKVFLHLTMSMTDVHQQV
YERIKAPLLTLVGAGSPEQSYSVLCHLHLLVMRAPMLFSSDYKSFYCQFSDPSYVKKLKL
EMLTAIANESNTYEIVTELCEYAGNVDVPIARESIRAVGKIALQQYDVNAIVDRLLQFLE
MDKDYVTAETLVLVKDLLRKYPQWSHDCIAVVGNISSKNIQEPKGKAALIWMLGEYSQDM
HDAPYILESLVENWDEEHSPEVRLHLLTAVMKCFFKRPPETQKALGDTLAAGLSDTHQDV
HDRALFYYRLLQYSPNVAERVVNPPKQAVSVFADTQSSEIKDRIFDEFNSLSVVYQKPSY
MFTDKEHRGPFEYSEDLTGLTEDPENVISAQRYQENDNDLLLSTSDKEDNGTRASNGSST
STYNAPSDLISPSLISSQAPAETSLVNTGGTYSSQSNFSLDDLLGLSVTEAPALPQPTLA
LNSKPVLDPGTFQRKWGQLALALSQECSLSPQGAVALMNPQSLIRHMQSNHIQCIASGGQ
PPNYKFFFYAQKDGAAAFFLVECIVNTASAKAQLKIKADDGTAAEAFSSLFQSALSKFGL
S*

Other information
Ka divergence:-0.420898KaKs divergence:-0.41796
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):3156Length 2 (bp):2526Length divergence:-0.111
MFE 1 (kcal):-1184.46MFE 2 (kcal):-818.9MFE divergence-0.182