Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC203985.4-GRMZM2G104942
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100216884

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.6157350970262
Log2 mRNA fold difference:2.1380694710981
Log2 TE fold difference:-0.67492677242927
Sequences
Protein sequence

MAQSQQMASKKPPGLRLFGGAGSLRTYQTLVLVLTFFAYACFHMTRKITSIVKSALDPQT
KMGFSHWGRLHLHTSEAPALNTGWLPFNTADGSALLGEIDVAFLAAYSIGMFFAGHIGDR
IDLRIFLTIGMVGTAVFTALFGAGYWLNVHSFYYFLVVQMVSGLFQSVGWPSVVAVVGNW
FGKSKRGLIMGVWNAHTSIGNIAGSLLAAFLLEFGWGWSFAVPSLVMALVGLVVYVSLPV
SPEVMEIDIAGSGELNCEKDTGTVKEPLLEPGQQVKHKAVGFLEAWRIPGVAPFALCLFF
SKLVAYTFLYWLPFYISHTRIGGVYLSDAMAGSLSTIFDVGGVLGGVLAGHISDRLNARA
ITAASFMYCAIPALFLYRAYGSTSMAWNVCLMFVTGMFVNGPYALITTAVSADLGTHSSL
NGNSRALATVTAIIDGTGSIGAAIGPLLTGYISSKSWSAVFTMLMAAALLAGLLLTKLVC
AELQGKTPTSASKDVADAQGTYYSDEV*

MLMSHSQQMANSRKPPGLRLLGGAGSLTTYQTLVLVLTFLAYTCFHMTRKIPSIVKSALD
PQTKVGFSHWGRLHASRNALTTGWLPFNTADGSALLGEIDVAFLAAYSAGMFFAGHIGDR
MDLRVFLTVGMAGTAVFTTLFGAGYWLNVHSFYYFLVIQMVSGLFQSVGWPSVVAVVGNW
FGKSKRGLIMGIWNAHTSVGNIAGSLLAAFLLKFGWGWSFAVPSLIMALVGLMVYVFLPV
SPEAMEIDSDGGELNCEKDAVKEPLLEPGQEVKHSAVGFLEAWRIPGVAPFALCLFFSKL
VAYTFLYWLPFYISHTRIGGEYLSDATAGSLSTIFDVGGVLGGVLAGHISDRLNARAITA
ASFTYCAIPALFLYRTYGSMSMAWNVSLMFVTGMFVNGPYALITTAVSADLGTHSSLNGN
SRALATVTAIIDGTGSVGAAIGPLVTGYVSSRSWSAVFTMLMAAALLAGLLLSKLVCAEL
QGKTHSSVSKDAGGEHGAYSDEV*

Other information
Ka divergence:0.0589434KaKs divergence:-0.306349
GC content 1 (%):58GC content 2 (%):60GC content divergence:0.017
Length 1 (bp):1524Length 2 (bp):1512Length divergence:-0.004
MFE 1 (kcal):-631.25MFE 2 (kcal):-653.61MFE divergence0.017