Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC205703.4-GRMZM2G092459
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100384280

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGDHSDSDSSPKSSSSSSSPSARRRSSPQRSRAHTDETGSSDGVLVELPTQEARSPGADP
DSGVLVNMPADDATSGETFDDAPEDLAAAGSLSARSLDESIAVIDFPEVSSTSAELRKYQ
EEKAVFAREAVALRRLLQEMLGQEASVALHGEDADETLLHSMLDDCSRLVLELNSMARAR
EQEIESLHARAAEAEVSSEVAHVYLGSWREGSEQAVGRMLASIDAVVRQDDASFEGADQD
GISILERKTSLLVERYRQASMGIEQLEQILAEVKPGFAATGHGDLATTLSVLSDELVGSK
RNEVDLLQKMNAFAEEKKAIADELEEVKAARNAVNAEASKAKAEFEQMEQKLSTTKEKLS
MAVTKGKSLVQHRDSLKQALAEKTGELQSCMTELQKKSDALQAAESRVDELQIFLDEKTS
EHEKCLDELRDTYSAWEAAKTSMEQLNESKSALHASLSLKDGVFERIEDIMSEATFPEDL
LSLEMTDRLGWLVEQKKIADMIFSEHQKVKEILSSVDIPHSVLTSELDSQISWLASSLNQ
AKDDAVRLRDESAEMLAKMAAHESKLVSMHEEIDRLTIILLEEKQEKDILLNEHSELMSL
YKAAVNKLSLVSSQNNELLKAFAEFFDVTLEGSQSMDIAKLVQQGLRNIQQRPKSSPIES
GSFEKLQALLYTLDQESTLCKMILEEDMINRSERTGELQRMAEEIIVLKNEKVSLQKEVE
RVEERSALLREKLSMAVKKGKGLVHEREGLKQALDEKRSQIENLKQVLEGKSSEIEKLKH
ALDENKSVTENVKQVLDGKNTEIERLKHALGDSCVETENLKQAFAEKTSEAYKIKQELDA
KNMDIENLRGAIESRESAMTDLREHVEHLLSSQVARLEKLQVDIVTLNDEKVKLESMLEE
ARASWDTLADSISSLTLPIDQPFEGPMEKFSQIAQYIQESQVAKSSLENELQKANEQITL
HASRHSDALSTINMLEHELSKLKDHISSISEEKRQMQLNTSAVQEELEKTNEELAINFRN
LESANTTINSLQDALSQARSNIFILAAEKNEAEAKYETEINALNAELTKCLEELDKTHGH
LQSHSTEYHGYLEKLGMFMMDDSLLSLIAEEYGKTFNSLRDMCLIVKSMHEQLSVKSFQN
DSIVEDSLFCAVK*

MDALSRPAVVIDNGTGYTKMGFAGNVEPCFITPTVVAVNDSFSGSGQPAARGAPARGNWL
AQHSAGVMADLDFYIGQEALARSRASSSHSLSYPIRNGQVENWDSMERFWQQCIFNYLRC
DPEDHYFLLTESPLTAPEIREYTGEIMFETFNVPGLYIAVQPVLALAAGYTTTKCEMTGV
VVDVGDGATHIVPVADGYVIGSSIRSIPITGKDVTQFIHQLLKERGENIPPEESFDVARR
IKEMYCYTSSDVVKEFNKHDREPSKYVKHWTGIKPKTGAKYTCDIGYERFLGPEIFFNPE
MYNNDFTTPLQVVIDRCIQSSPIDTRRALYKNIVLSGGSTMFKDFHRRLQRDLKKIVDAR
VRASNSRLLSGDAKFFSDNIIYDFQAQPIEVNVVSHPIQRYAVWFGGSVLASTAEFYEAC
RTKAEYEEYGASICRSNPVFKGMY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):3462Length 2 (bp):1335Length divergence:-0.443
MFE 1 (kcal):-1096.84MFE 2 (kcal):-460.1MFE divergence-0.409