Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC206968.3-GRMZM2G019468
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3245255155491
Log2 mRNA fold difference:-1.1503643204023
Log2 TE fold difference:-0.15567802709139
Sequences
Protein sequence

MSSSMESSYLPATTESLAQAQEAKDASESISILYRVIQDPSSSADALRTKEVAITNLTNY
LTKENRAEELRNLLTQLRPFFAVIPKAKTAKIVRGIIDAVAKIPGTSDLQISLCKEMVEW
TRAEKRTFLRQRVEARLAALLLENQEYTEALTLLTSLIKEVRRLDDKLLLVDIDLLESKL
HFSLRNLPKAKASLTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFE
AFSALEDPKAIFSLKYMLLCKIMVNQADDVAGIISSKAGLKYLGPDVDAMKAVADAYSKR
SLKYFETALRDYKSQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAEMIELP
IDHVEKKLSQMIVDKKFAGTLDQGAGCLIIFEDSKTEEIFPATLETISNVGKVVDSLYVR
SAKIMA*

MTSYFLWTLTFWKSKLHFSLRNLPKAKASLTAARTAANAIYVPPAQQGTIDLQSGILHAE
EKDYKTAYSYFFEAFEAFSALEDPKAIFSLKYMLLCKIMVNQADDVAGIISSKAGLKYLG
PDVDAMKAVADAYSKRSLKYFETALRDYKSQLEEDPIVHRHLSSLYDTLLEQNLCRLIEP
YSRVEIAHIAEMIELPIDHVEKKLSQMILDKKFAGTLDQGAGCLIIFEDSKTEEIFPATL
ETISNVGKVVDSLYVRSAKIMA*

Other information
Ka divergence:0.8045KaKs divergence:-0.996028
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1281Length 2 (bp):789Length divergence:-0.238
MFE 1 (kcal):-394.8MFE 2 (kcal):-240.9MFE divergence-0.242