Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC207265.3-AC234171.1
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.68546319317891
Log2 mRNA fold difference:0.73129300632338
Log2 TE fold difference:-0.023012743410882
Sequences
Protein sequence

MAVGGTQPVLRKYLGALKDTTTVSLAKVNSDYKELDIAIVKATNHVERPSKEKYIREIFH
SISAARPRADVAYCIHALARRLSKTRNWAVALKTLIVIHRALREVDPTFREELLNYGRSR
SHMLNMAYFKDDSSAEAWDYSAWVRIYALYLEERLECFRVLKYDVETDPPRTKDLDTVDL
LDHLPQLQQLLFRLLACQPQGASSYNVIIQHALSMVALESVKIYTAISDGTINLVDKFFE
MQRNDAVRALDVYKRATNQAERLSEFHEVCKTIHIGRGEKFLKIEQPPASFLQTMEDYVR
DAPTGQKQKTILAIEYKKEPEEEEKPASPPPAPEQEPEQEPEPEPEPVKEEAPEAEPDLL
GLNEPSPAATAIEEQNALALAIVPIDDVPGAAPTFENGVTGWELALVTAPSSTETAVAPS
KKLAGGLDLLTLDSLYDEANRRASQPASYNPWDATASAPMMTTMAPAMHDPFYASNGYAA
PHGVQMAAMAHHQQQQQVFMLQQQMMAPAPAVHHPMQMQQNPANPFGNPFAAAGAHPYGA
AGMPLHAGPGNVYTGLI*

MAVGGTQPVLRKYLGALKDTTTVSLAKVNSDYKELDIAIVKATNHVERPSKEKYIREIFH
SISAARPRADVAYCIHALARRLSKTRNWAVALKTLIVIHRALREVDPTFREELISYGRSR
SHMLNMAYFKDDSSAEAWDYSAWVRIYALYLEERLECFRVLKYDVETDPPRTKDLDTVAL
LDHLPSLQQLLFRLLACQPQGASSYNVIIQHALSMVALESIKIYTAISDGTINLVDKFFE
MQRNDAVRALDVYKRATNQAERLSEFYEVCKTIHIGRGEKFLKIEQPPASFLNTMEEYVR
DAPTGQKEKAILAIEYKKEPEEEEKPSSPPAAPEPEPEQVPEPEPEPVKEEAPEAEPDLL
GLNEPNPAATAIEEQNALALAIVPIDDAPKAAPTFGNGVTGWELALVTAPSSNETAVAPS
KKLAGGLDLLTLDSLYDEANRRASQPASYNPWEATPAAPAPMMTMAPVMHDPFYASNGYA
APHGVQMAAMAQQQQAFMLQQQQMMTMAPAQPVVHHPMQMQQNPANPFGNPFAAAGMPLH
AGPGNVYTGLI*

Other information
Ka divergence:-0.173294KaKs divergence:0.16975
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):1674Length 2 (bp):1656Length divergence:-0.005
MFE 1 (kcal):-598.35MFE 2 (kcal):-577.33MFE divergence-0.018