Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC207347.3-GRMZM2G066801
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):major facilitator superfamily protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.2966185162204
Log2 mRNA fold difference:1.9689215047231
Log2 TE fold difference:0.351981570731
Sequences
Protein sequence

MECQEKNNICNEHASKVAHVRRRRASKEGCLNSQATVNWRPNTSHKNKIGHRKIDTDTHS
THQISVVRSRCYTHWFSESAGAAHMETYTTDDALTLMGFGKFQALVLAYAGMGWVAEAME
VMLLSFLGPVVREEWNVSPQDESLLSSVVFAGMLIGACAWGFISDRYGRKTVLLLSTLLT
SGLGLLSALSINYLCLLVLRFFVGIGVGSGHVFSSWFLEFVPAGNRGTWMAVLSALSWRW
LLALSSLPCFLLLLFFRITPESPRYLCAQNRMTDARFVLERMAIANQAALPMGVLTYHQE
TKTECITHVSEDEHLIPVREKEHTDRNAISSKSGAVAVLHKLLSHNLLKSTLLLWFVYYA
SSFAYYGITLLTSQLSDVNRSCKSDLVFEVHQNNGNLYKDTFITSLAARACGTGATTTLC
LYAPEVYPTYVRSTGVGIATAIGKIGGVICPLVAVGMLRSCHQMEAVLVFELVLFLAGVS
CILFPVETKGREMD*

METYTTDDALTIMGFGKFQALVLFYAGMGWVAEAMELMLLSFLGPFIREEWNVSPENESL
LSSVVFAGMLLGACAWGFVSDKYGRRTGLIFSTLFTSGMGFLSALSPNYLCLVALRFLVG
VGVGGSHVFISWFLEFVPAQNRGTWMVIFSLFWTLGTILEASLAWVVLPALNWRWLLVFT
ALPCFLLLPFFGLTPESPRYLCAQNRMSDATSVLERMANANQSALPPGVLTYNRQTKCDH
DVLAPESECLLPVREKECTVDNAKSSESGSLAALRMLLSRELLRSTLLLWFVFYANSFAY
YGLVLLTSQLSDANKSCASGVSFGLRQKEINLYKDTFITSLAEIPGLFLSAVLVDWFGRK
ASMWSMMFACCAFLGPLVLQQTELLTTILLFGARACAMGSFTVLCLYAPEVYPTFVRSTG
AGIATAIGRIGGVVCPLVAVAMLRSCHQMEALIVFEVILCLAAVACMFFPVETKGRGMD*

Other information
Ka divergence:-0.191221KaKs divergence:-0.480717
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1485Length 2 (bp):1440Length divergence:-0.015
MFE 1 (kcal):-480.9MFE 2 (kcal):-469.86MFE divergence-0.012