Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC209208.3-GRMZM2G093316
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381765

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.097489976845055
Log2 mRNA fold difference:0.032475859583423
Log2 TE fold difference:0.062606918371971
Sequences
Protein sequence

MPPWWGKSSSKEVKKSAKENLIDTFQRLISSNEQKGSRKSRSSRRHGKDTAGDKGCWSTA
QSRSTSPSKEVSRCQSFAADRPHAQPLPLPKSRAKVTRTSSDITNSKSTLEKHGKGQLLP
LPPIQPKKRPEATEPVTEVATASVSSNCSIDSDDPGDSQLQSPVGNEAENATRITATSSS
SVVRKECSSAITRKNTKEVAKPNSAFLSNQILSTSPRGTFADGYQSNLQSPRQIALESAP
NSLMSSPSRSPRNICPVQIPTSAFWAIKPHTDVTFLGSGQCSSPGSGQTSGHNSVGGDML
GPIFWQPSRGSPECSPIPSPRMTSPGPSSRVHSGSVSPLHPRAGGVTPESPTNRHAEGNK
KQTHRLPLPPLSIANSSTFLPNSSNPTSPISRSPGRTENPPSPGSRWKKGKLIGRGTFGH
VYAGFNSDRGEMCAMKEVTLFSDDPKSKESAKQLCQEISLLSRLQHPNIVRYYGSETVDD
KLYIYLEYVSGGSIHKLLQEYGQFGEQAICSYTKQILLGLAYLHAKNTVHRDIKGANILV
DPNGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPEVIKNASGCNLAVDIWSLGCTVLEM
ATSKPPWSQYEGIAAMFKIGNSKELPPIPDHLSEEGKDFIRQCLQRDPSSRPTAVDLLQH
PFVQNAPPLEKSSASHPLEQLTAISCRTNSKVVEHARNMSSLGLEGQSILQRRAAKFSLP
NSPRTTSGASTPLTGGSGAVPLNHVRQPAYRNEGFTVTSRGFDDHMPSRPVDPVHGRFIR
VQQFSVGRQERVVSEVDILSSQYGKMRHANVWDPHDRPLPSERSSQQCFGNHAKLKPSLD
LRSDADSWQWIKILKCQSHIPITLKKFSFSSMGLEAIVQKGTLNKKSRLHGTGESNGPVV
REPIPYRFAPFTFENALAACELRAKTIKGTTHVPWRRVRRQQASNALAISSQGPPSSSLL
HLSSIMFVLTPIMALPEGHPHTPGPPSL*

MPPWWGKSSSKEVKKTAKENLIDTFQRLISSNEQKGSKKSRGSRRHGKDTAGDKGCWSTA
QSRSTSPSKEVSRCQSFAADRPHAQPLPLPKSRARVSRSSSDITNSKSTLEKHGKGQLLP
LPPIQPKKTPEATEPVTEVATASVSSNCSIDSDDPGDSRLQIPVGNETENATRITATSSS
SVVHKERSSAITRKNTKEVAKPNNVFLSNQILSTSPRGTVADGYQSNLQSPRQIALESAP
NSLMSSPSRSPRIICPDQIPTSAFWAVKPHTDVTFLGSGQCSSPGSGQTSGHNSVGGDML
GPIFWQPSRGSPECSPIPSPRMTSPGPSSRVHSGSVSPLHPRAGGVTPESPTNRHAEGNK
KQTHRLPLPPLSIANSSTFLPNSSTPASPISRSPGRTENPPSPGSRWKKGKLIGRGTFGH
VYAGFNSDKGEMCAMKEVTLFSDDPKSKESAKQLCQEISLLSRLQHPNIVRYYGSETVDD
KLYIYLEYVSGGSIHKLLQEYGQFGEQAIRSYTKQILLGLAFLHAKNTVHRDIKGANILV
DPNGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPEVIKNASGCNLAVDIWSLGCTVLEM
ATSKPPWSQYEGIAAMFKIGNSKELPPIPDHLSEEGKDFIRQCLQRDPSSRPTAVDLLQH
PFVGNAPPLEKSSASNPLEQLTTISCRTNWKVVEHARNMSSLGLEGRYQSILQRRAAKFS
LPNSDIRIQSNISCPVSPCGSPLLRSRSPQHQNGRMSPSPISSPRTTSGASTPLTGGSGA
VPLNHLRQPAYRNEGFTVTSRGFDDHIPSRLVDPVHGRFIRVQQLSAGRQERVVSEADIL
SSQFGKMRHANVWDPHDRPLPSERSSQQCFGDHAKLKPSLDLRSGPLHPGRNHGH*

Other information
Ka divergence:-0.317206KaKs divergence:-0.355304
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2967Length 2 (bp):2688Length divergence:-0.049
MFE 1 (kcal):-921.69MFE 2 (kcal):-832.03MFE divergence-0.051