Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC209208.3-GRMZM2G392975
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Aquaporin PIP1-3/PIP1-4 (Plasma membrane intrinsic protein 1-3)(ZmPIP1-3)(ZmPIP1;3)(Plasma membrane intrinsic protein 1-4)(ZmPIP1-4)(ZmPIP1;4)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPPWWGKSSSKEVKKSAKENLIDTFQRLISSNEQKGSRKSRSSRRHGKDTAGDKGCWSTA
QSRSTSPSKEVSRCQSFAADRPHAQPLPLPKSRAKVTRTSSDITNSKSTLEKHGKGQLLP
LPPIQPKKRPEATEPVTEVATASVSSNCSIDSDDPGDSQLQSPVGNEAENATRITATSSS
SVVRKECSSAITRKNTKEVAKPNSAFLSNQILSTSPRGTFADGYQSNLQSPRQIALESAP
NSLMSSPSRSPRNICPVQIPTSAFWAIKPHTDVTFLGSGQCSSPGSGQTSGHNSVGGDML
GPIFWQPSRGSPECSPIPSPRMTSPGPSSRVHSGSVSPLHPRAGGVTPESPTNRHAEGNK
KQTHRLPLPPLSIANSSTFLPNSSNPTSPISRSPGRTENPPSPGSRWKKGKLIGRGTFGH
VYAGFNSDRGEMCAMKEVTLFSDDPKSKESAKQLCQEISLLSRLQHPNIVRYYGSETVDD
KLYIYLEYVSGGSIHKLLQEYGQFGEQAICSYTKQILLGLAYLHAKNTVHRDIKGANILV
DPNGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPEVIKNASGCNLAVDIWSLGCTVLEM
ATSKPPWSQYEGIAAMFKIGNSKELPPIPDHLSEEGKDFIRQCLQRDPSSRPTAVDLLQH
PFVQNAPPLEKSSASHPLEQLTAISCRTNSKVVEHARNMSSLGLEGQSILQRRAAKFSLP
NSPRTTSGASTPLTGGSGAVPLNHVRQPAYRNEGFTVTSRGFDDHMPSRPVDPVHGRFIR
VQQFSVGRQERVVSEVDILSSQYGKMRHANVWDPHDRPLPSERSSQQCFGNHAKLKPSLD
LRSDADSWQWIKILKCQSHIPITLKKFSFSSMGLEAIVQKGTLNKKSRLHGTGESNGPVV
REPIPYRFAPFTFENALAACELRAKTIKGTTHVPWRRVRRQQASNALAISSQGPPSSSLL
HLSSIMFVLTPIMALPEGHPHTPGPPSL*

MEGKEEDVRLGANKFSERQPIGTAAQGAGAGDDDKDYKEPPPAPLFEPGELKSWSFYRAG
IAEFVATFLFLYITVLTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHIN
PAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTK
GDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGI
NPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRAIPFKSRS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):63GC content divergence:0.156
Length 1 (bp):2967Length 2 (bp):879Length divergence:-0.543
MFE 1 (kcal):-921.69MFE 2 (kcal):-375.48MFE divergence-0.421