Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC209257.4-GRMZM2G009968
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):electron transporter

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.6071833414468
Log2 mRNA fold difference:-0.7617212007191
Log2 TE fold difference:3.1324613611
Sequences
Protein sequence

MGQGGSGLDQGTARRNGARATRAQEHQRRRGGEHRRRCNSTAATPTPRITGSDTTVIPVA
TPARSIREPIGLDRVGFGLGKWAALVPAAGAGASSRLSIPNPSLKDLRSLLAPDSAATAP
PSASPSPRVLHRIRVAASALRALRTLHQPPSRPPAAPVGKDKEPVPGGGRVVLYFTSLRV
VRGTYEDCRAVRAILRGLRAAVDERDLSMDPGHLPELAALLPRVALPQVFVGGRHLGGAD
EVRRLHESGELRRIVAPAPGPAFSGSCARCGGERYLLCGACDGSHKRYSLKGGGGFRACA
ECNENGLVRCPACCVPVPVA*

MWPSWVKTRSSDDSAVGAAASTSTAVGACPRLSIPNPCLKDLRSLLSPDSSASPAPRVFH
RLRVAASALRVLRAIQHPASQSPAGGKEPAPGACGGGRVVLYFTSLRVVRGTYEDCRAVR
AILRGLRAAVDERDLAMDPGYLPELASLLPHAPRGRVALPQVFVGGRHVGGAEEVRRLHE
AGELRRIVAPASSGGSCARCGAQRYVLCAACHGSHKRYSLKGGGGFRSCAECNENGLVRC
PACCVVPAS*

Other information
Ka divergence:-0.0299324KaKs divergence:0.285442
GC content 1 (%):74GC content 2 (%):76GC content divergence:0.013
Length 1 (bp):963Length 2 (bp):750Length divergence:-0.124
MFE 1 (kcal):-496MFE 2 (kcal):-392.36MFE divergence-0.117