Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC209374.4-GRMZM5G835542
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.11306037903688
Log2 mRNA fold difference:1.0116094700199
Log2 TE fold difference:-1.1303920930337
Sequences
Protein sequence

MATAPYASSLFLASSPISTAPRIRAGPCPPSAQPSLRLRPRPSPAAAAAVQAEHQPALTA
APKPPALPFRVGHGFDLHRLEPDLPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGAL
GLPDIGQIFPDSDPRWKGADSSVFMREAVKLMHEAGYELGNLDATLILQKPKISPFKETI
RSNLCDLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK*

MATAPYASSLFLASSPISTAPRASAGSFPPSAQPFSMRLRPRPSPAVAAAVQAEHQPAVA
ATPKPPALPFRVGHGFDLHRLEPNLPLIIGGIDIPHDRGCEAHSDGDVLLHCVVDAILGA
LGLPDIGQIFPDSDPRWKGADSSVFMREAVKLMHEAGYELGNLDATLILQKPKISPFKET
IRLNLCNLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK*

Other information
Ka divergence:0.768295KaKs divergence:0.25259
GC content 1 (%):63GC content 2 (%):62GC content divergence:-0.008
Length 1 (bp):678Length 2 (bp):681Length divergence:0.002
MFE 1 (kcal):-275.44MFE 2 (kcal):-282.66MFE divergence0.013