Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC209636.2-GRMZM2G082959
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.11578702826371
Log2 mRNA fold difference:-2.3070852342412
Log2 TE fold difference:2.9449794000183
Sequences
Protein sequence

MATANVQQQPQPQVVAAVGRKVVDEVSGWLRVLEDGSVDRTWTGPREALPLMEPVAPYAV
PRDGHTLHDLPGEPNLRVYLPEANVEAGGARLPVILQLHGGGFCISHPSWLMYHHFYARL
ACAVPAVVVAVELPLAPERRLPAHIDAGVAALRRLRSVALAEDDGALDDPAAALLREAAD
VSRVFLVGDSSGGNLVHLVAARVAREADAGSWAPLRVAGGVPIHPGFVRATRSRSELETK
ADSVFFTLDMLDKFLALALPEGATKDHPFTCPMGPQAPPLESVHLPPLLVSVAENDLIRD
TNLEYCNALRAAGKEVEVLINHGMSHSFYLNKYAVDMDSTTGERARELIDAIKSFISRH*

MAPAIAQQQPQVQPIGVGGRKVVDEVSGWLRVLDDGSVDRTWTGPLEALPLMEPVAPYAQ
PRDGHTLHDLPGEPNLRVYLPEMEAGDGARLPVVLHLHGGGFCISHPSWLMYHHFYARLA
RAVPAAVVAVELPLAPERRLPAHVHAGVAALRRLRSIALSASESESEDGALDDGPAAALL
RQAADVSRVFLVGDSSGGNLVHLVAAHVAREAADDAGSWAPLRVAGGVPIHPGFVRAARS
RSELETKADSVFFTLDMLDKFLALALPEGATKDHPFTCPMGPQAPPLESVPLPPMLVSVA
ENDLIRDTNLEYCDALRAAGKEVEVLINRGMSHSFYLNKYAVDMDPATGERTRELIDAIK
SFISRH*

Other information
Ka divergence:0.142912KaKs divergence:0.0481078
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1080Length 2 (bp):1101Length divergence:0.01
MFE 1 (kcal):-562.8MFE 2 (kcal):-535.6MFE divergence-0.025