Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC209784.3-GRMZM2G310431
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Heat shock 70 kDa protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MARGLGAAPVSSCLALGAAAAVLLVAAALPSPASGVDVTAVLSAFPNFADFARLLASTPV
ASELSGRSSLTLLAVPNANLPQSPSAFVASAGADIADVLRYHVLLEYLFPFDLARLSPSG
KLVTTLFQTTGRAPSDFGAVNLTVGGNSTVVVRSPAPSPGSNATVLGAVTAVPYNLSVLA
VGGLIIPSGFDLAASESRPPPPVNITRVLTDARGFNVAASMLQASGVASEFEADEHSAGI
TVFVPTDDAFAGLPATDRLQSLPAERKAVVLRFHVLHSYYPLGSLESSTASATSSTLIDA
WGERFVALDRGSLRHPQWQEVAEVVSSRDSYSKAPKSDVQCKNRIDTLKKKYKVEKAKHD
SDWRYFDRLDDLLAPVLLKPNSSSSSAAAATAAAAARSAGPMVPPRINFPQRTRTPLHSS
AGAKWRMPSPLPQPSASSDSSDGFPPSAVANGKRQRVEEPAAAAADNGAESSVSRAQGLR
ELAQAIRRLGEVYERVESAKRDQELRMERERLDSARQLEEQRVQFSTSMPRSSRITRTAQ
APPGAMTTAATRTRKLRRMRKTKRKRASDCSPLQQWNGIVQASITRTVFDQNPVAVFAVS
KVLLPKEMFGRGDSGNTAMAPPSVAMAPRDAGSEKTPQTRLSSPPDLHSEDSESSASLLT
AKGTWWCIGLMYLQLHLLLSLV*

MAKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQ
VAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAE
EISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPT
AAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN
RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYS
TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIP
RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQIT
VTFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEVKKK
VDAKNALENYAYNMRNTIKDDKIASKLPAEDKKKIEDAVDGAISWLDSNQLAEVEEFEDK
MKELEGICNPIIAKMYQGEGAGMGAAAGMDEDAPSGGSGAGPKIEEVD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):59GC content divergence:-0.056
Length 1 (bp):2049Length 2 (bp):1947Length divergence:-0.026
MFE 1 (kcal):-945.48MFE 2 (kcal):-811.06MFE divergence-0.077