Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC210173.4-GRMZM2G100158
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100273589

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4355300011433
Log2 mRNA fold difference:1.1675370990475
Log2 TE fold difference:0.27704325141014
Sequences
Protein sequence

MVTVAKIAMEWLQDPLSWVFLGTLALVVLQLRRRGKAPLPPGPKPLPIVGNMAMMDQLTH
RGLAALAERYGGLLHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATIAIAYLTYDRA
DMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDECAALVRAVASGGGGGGEAVNLGE
LIFNLTKNVTFRAAFGTRDGEDQEEFIAILQEFSKLFGAFNVVDFLPWLSWMDLQGINRR
LRAARSALDRFIDKIIDEHVRRGKNPDDADADMVDDMLAFFAEAKPPKKGPAAAADGDDL
HNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDLRRLQQELADVVGLDRN
VNESDLDKLPFLKCVIKETLRLHPPIPLLLHETAGDCVVGGYSVPRGSRVMVNVWAIGRH
RASWKDADAFRPSRFTPEGEAAGLDFKGGCFEFLPFGSGRRSCPGTALGLYALELAVAQL
AHGFNWSLPDGMKPSELDMGDVFGLTAPRATRLYAVPTPRLNCPLY*

MAAAVANIGMEWLQDPLSWVFLGTVCLVVLQQLRRRRGKAPLPPGPKPLPIVGNMGMMDQ
LTHRGLAALAETYGGLLHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATAAIAYLTY
DRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWAAVRDECAALVRAVAVGGGSGGEAVN
LGELIFSLTKNVTFRAAFGTRDGEGQEEFIAILQEFSKLFGAFNVGDFLPWLGWMDLQGI
NRRLRAARSALDRFIDKIIDEHVRRGKSPDDADADMVDDMLAFFVEATPGKATGAAAAAD
GGDDLHNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDLRRVQQELADVV
GLDRNVSESDLDRLPFLRCVIKETLRLHPPIPLLLHETADDCVVAGYSVPRGSRVMVNVW
AIGRHRASWKDADAFRPSRFAAPEGEAAGLDFKGGCFEFLPFGSGRRSCPGMALGLYALE
LAVAQLAHAFNWSLPDGMKPSEMDMGDIFGLTAPRATRLYAVPTPRLNCPLY*

Other information
Ka divergence:0.212302KaKs divergence:-0.31784
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1581Length 2 (bp):1599Length divergence:0.006
MFE 1 (kcal):-797.1MFE 2 (kcal):-846.1MFE divergence0.03