Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC211401.4-GRMZM2G122863
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279455

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4809243391728
Log2 mRNA fold difference:-1.2913702643798
Log2 TE fold difference:-0.18277008103336
Sequences
Protein sequence

MLRQSSSRNQRSKGLKLKKALQISLLLLVSVWLLYQVKHSYEKKAYSEDEVSGSHKDDKD
QGETVRLGRKDLPPKMEADSSTLDERVEDEENDEMEQEMKHDENDDDPIDEQDLEKDEDL
PEPGEHSSERDGDVGVFDDEERKERSQEDQEKSFHGDNVSSAVTHDPPSSEQDELFHRGQ
EKVLFVDDASTAVPNENHEAGNEDEVRRARERSFRGDDVSSSVDHDGKVTKPLPEEQLNI
MDRIFEGTTNLSNGISFRAPGINGSYTTAGNVATPTNSSSQKNTDIPSDDIESKTHPSPT
NLTSNPEQTNSTLKGHPDQQVNSMAVLGNQVQPLTNQTSLELDSPPNGTLALVTDAKKST
SGAGDDGSNSTSPSTHVDKKTDGGDGPKEDVDVSTKIMNKAISEDEVVPE*

MLRQSSSRNQRSRGLKLKKALQISLLLLVSVWLLYQVKHSYEKKAAYSEGEVNDLHKDDK
GQGEAVRLGRKDVPPKMEADSSTLDERVEDEENDEVEQEMKHDENDEDPIDEQDLEKDED
LPEPGEHSSEKDEDVGVFEDEERKERSQEDQEKSFHGDDVSSAVTHDPQSSEQDELFHHA
QDTVLFVDDASTAVPNENHVAGNDEEEVQRARERSFRGDDVSSSVDHDAKVAKPLPEEQL
NSMDKIFEGTTNLSNGISFRAPGINGSYAGMDNVATVPTNSPSQKNAGTPSNDIESKTHP
SPANLTGPEQSNSTLKDHPDQQVNSTAVLGNQVQPLTNQTPWPELDSPNGTLALVTDVQK
STSGAGDDGSSTVDKRTDGRDGPKEDVDVSTKIMNRAISEDEVVPE*

Other information
Ka divergence:0.0999127KaKs divergence:-0.068794
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1233Length 2 (bp):1221Length divergence:-0.005
MFE 1 (kcal):-379.65MFE 2 (kcal):-392.88MFE divergence0.017