Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC212219.3-GRMZM2G117246
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.76344944530352
Log2 mRNA fold difference:-2.3336839209198
Log2 TE fold difference:1.6878213806078
Sequences
Protein sequence

MAISCFNGGAGWPEPVVRVQAVSDTCGDTIPERYVKPLSERPRLSPASDGSGPNIPVVDL
SMLDVDATSSAVAAACREWGFFQAVNHGVRPELLRGARAAWRGFFRQPAEVRERYANSPA
TYEGYGSRLGTAKGGPLDWGDYYFLHLLPASLKSHEKWPSLPSSLRGATEEYGEEVLQLC
RRVMRLLSSGLGLEAGRLQAAFGGEGGEGACLRVNFYPQCPQPELTLGVAGHSDPGGMTM
LLVDDHVKGLQVRSPDGQWIVVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRVTVSAAEDR
LSMAFFYNPRSDLPIAPMAELVGPDRPALYPEMTFDEYRVFIRQRGLAGKAQLESLQVKA
TAGGGGCSAAAASSTS*

MHAVGRLVLTLKPAPMTSCFNSGAGWPEPVVRVQAVSDTCGDTIPERYVKPLPERPRLSP
ASDVGGGRNIPVIDLSMPDVDATSRAVAAACREWGFFQAVNHGVRPELLRGARAAWRGFF
KQPAEVRERYANSPSTYEGYGSRLGTAKGGPLDWGDYYFLHLLPSSLKNHEKWPSLPYSL
RGTTEEYGEEVLHLCRRVMRLLSSGLGLEAGRLQAAFGGEGGEGACLRINFYPRCPQPEL
TLGVAGHSDPGGMTMLLVDDHVKGLQVRGPDGQWIIVDPVPDAFIVNIGDQIQVLSNAAY
KSVEHRVTVSATEDRLSMAFFYNPRSDLPIAPMAELVGPGRPALYPEMTFDEYRVFIRQR
GLAGKAQLESMQKAAATAADGGRRQLVHQLAATEHIISRASWSVSDA*

Other information
Ka divergence:0.238562KaKs divergence:0.270817
GC content 1 (%):68GC content 2 (%):66GC content divergence:-0.015
Length 1 (bp):1131Length 2 (bp):1224Length divergence:0.039
MFE 1 (kcal):-564.3MFE 2 (kcal):-577.17MFE divergence0.011