Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC213521.3-GRMZM2G107402
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6263596474727
Log2 mRNA fold difference:-1.9959638416238
Log2 TE fold difference:0.35365974329419
Sequences
Protein sequence

MMASTASATAAAAAVAFGAAAKPRGPAAVALRARVPAGGRRRSGVVVRCDAGVEVQAQAV
AKAASIAALEQFKISADRYMKERSSVAVIGLSVHTAPVEMREKLAVAEELWPRAIQELTS
LNHIEEAAVLSTCNRMEIYVVALSWNRGIREVVDWMSKKSGIPASELKEHLFMLRDSDAT
RHLFEVSAGLDSLVLGEGQILAQVKQVVRSGQNSGGLGKNIDRMFKDAITAGKRVRSETN
ISSGAVSVSSAAVELALMKLPKSEALSARMLLIGAGKMGKLVIKHLIAKGCKKVVVVNRS
VERVDAIREEMKGIEIVYRPLSEMYEAAAEADVLFTSTASETPLFTKEHAEALPTISDAM
GGARLFVDISVPRNVSACVSEIDSARVYNVDDLKEVVEANKEDRLRKAMEAQTIIAEELK
RFEAWRDSLETVPTIKKLRSYADRIRASELEKCLQKIGDDALTKKTRRAIEELSTGIVNK
LLHGPLQHLRCDGGNSRTLDETLENMHALNRMFGLDTEKAIVEQKIKAKVEKIQN*

MMASTAPAASTAVAFGAAATPRGPASASAALCARVPAAAGGMRRSGVAVRCDAGADAQVR
AVAKAASVAALEQFKISADRYMKERSSIAVIGLSVHTAPVEMREKLAVAEELWPRAIQEL
TSLNHIEEAAVLSTCNRMEIYVVALSWNRGIREVVDWMSKKSGIPASELREHLFMLRDSD
ATRHLFEVSAGLDSLVLGEGQILAQVKQVVRSGQNSGGLGKNIDRMFKDAITAGKRVRSE
TNISSGAVSVSSAAVELALMKLRKSEALSARMLLIGAGKMGKLVIKHLIAKGCKKVVVVN
RSAQRVDAIREEIKAIEIVYRPLSEMYEAAAEADVVFTSTASETPLFTKEHADALPTVSD
AMGGVRLFVDISVPRNVSACVSEIGSARVYNVDDLKEVVEANKEDRLRKAMEAQTIITEE
LKRFEAWRDSLETVPTIKKLRSYADRIRASELEKCLQKIGDDVLTKKMRRAIEELSTGIV
NKLLHGPLQHLRCDGSNSRTLDETLENMHALNRMFSLDTEKAIIEQKIKAKVEKTQN*

Other information
Ka divergence:0.0885257KaKs divergence:0.162648
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):1608Length 2 (bp):1614Length divergence:0.002
MFE 1 (kcal):-622.72MFE 2 (kcal):-631.22MFE divergence0.007