Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC213654.3-GRMZM2G409635
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100277941

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPEWPFVKRRMAPRHLGRSRPAPTPKPFGEHAKWSTTRVSDRAYSILYLLHPPCHCPLRA
LHRLGRRSRTLWLGLAMSEGARNTRQFFAASTSGSGSSSATYRDGGGGIGVARASLVNTG
ILDENVLALVFRYLNFDPKALCTVSCVSRRLRAVAERVLWRELCVSRAPRMVASLAGGGA
PPGRVVGGWPALAKLLLFCCGAAAAAVRGHFTGVSRFSKTSGRSFLSRRCRGDLLYVSDP
CEHAVHGADDDVGAYRGVFRGFTRSRTRACLVGRRAPLETRVRCPYCGARVWSMVAAGMA
PRSACRRLGAHEGRLQYYVCVSGHLHGNCWLARLTSSDADRDADSEDDASTEGGDDGAHV
AP*

MAAEAQAEGRALPRAPPPPLARGGSSASPEKRGLPIPGFDGVAEEEEERVPEPKRRRAWV
AALDSAVAGCGGDGDGGSFSFQHAPGCFVAPEATPKFGSFNPPGDQAELAGLDPKPVGRE
ADAEDSPEAGDEVSAASAPGAEAKDERLMA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):72GC content 2 (%):74GC content divergence:0.014
Length 1 (bp):1089Length 2 (bp):453Length divergence:-0.412
MFE 1 (kcal):-606.1MFE 2 (kcal):-250.1MFE divergence-0.416