Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC217050.4-GRMZM2G091155
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100285226

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDEVATAALAAARGRWTQWEEVVVSNDRGSRLVHYYLRGNGEAKELAVVGRERSPRHMSY
AVQGRFLRALAAAAGAVAVASSPSRSPLAAAVADGGAPRRWRSRREVVEWLSSLVSDFDD
FERGLARLVLFLARFGVTFCVEIALVLGPIEGGSCSGSLLFVFGAFYAVEHHSSLIWPEE
PPCLAIFGYSYGSSMANRCNGDSYDDSVINCSQVTVSKDVSSREASNDFTWLGASWKCQR
SLKHYKSFCRRGITISVHSFVYIMGEEMKRLIAYVEDLYEDTNSCNMVKVQWFGKADEVG
VLLPMDFDDREIFFSLGRQDLNVVCIDGLAAVLSAQHYEKFKSDTRYSLWQPYFCYRQID
NGEAKPFDVTQLQGYWSQEVLRTMFNATSCLKVRFKVPKSGPNSDGGLKRKRDAFNNDAN
RQKFICSGAFTSRFYGENIEHLCPGCHVEVLSQDSGIKIKSRVRYLELQDADETGNLEEW
VLLTRIAKPDQLGVRFLGRPMVRPQHVEESKASCFDVGAIVDAWWHGGWWEGIVLCQGGR
GRLQVYFPGEKRITEFGEDELRYSLEWVGNKWNPLKGRKDIAHKLTSTADRGSEYLIGKQ
DHLNFDVLLKPEPQLEGLQYDKRGIEKSSVTTISRDQKRVLADLTNDLKLDSLRWRPRKR
SRRSGSRKQSDTSSGSSSGDMDLSSPGPSGFCQLNLVPDDETCKSSGEQPFMGVPVQAPK
SDCLPLHAPKFRAYAIQPTDQPSMRGETSAFSVVRALATASLVAEPSSRRASSSLATKLG
EKRSWVGGSGGGPLRALRSEEEGRVKRATEVAAVEAVPRRRIAIAKCLRCPPPSFKVVGD
KRKRSSSPPSSSSSIRSSALDLSRERYDLRFRLRICSIQFALYFVRFF*

MSREENVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRAS
WRIVSSIEQKEESRKNEEHVNLIKEYRGKIEAELSNICDGILKLLDSHLVPSSTAAESKV
FYLKMKGDYHRYLAEFKTGAERKESAESTMVAYKAAQDIALAELAPTHPIRLGLALNFSV
FYYEILNSPDKACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDLTEDG
ADEGKDAPKGDAGEGQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):2667Length 2 (bp):771Length divergence:-0.551
MFE 1 (kcal):-1023.68MFE 2 (kcal):-250.2MFE divergence-0.607