Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC217050.4-GRMZM2G419305
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.070690690575
Log2 mRNA fold difference:1.3241824117107
Log2 TE fold difference:-0.25655875868283
Sequences
Protein sequence

MDEVATAALAAARGRWTQWEEVVVSNDRGSRLVHYYLRGNGEAKELAVVGRERSPRHMSY
AVQGRFLRALAAAAGAVAVASSPSRSPLAAAVADGGAPRRWRSRREVVEWLSSLVSDFDD
FERGLARLVLFLARFGVTFCVEIALVLGPIEGGSCSGSLLFVFGAFYAVEHHSSLIWPEE
PPCLAIFGYSYGSSMANRCNGDSYDDSVINCSQVTVSKDVSSREASNDFTWLGASWKCQR
SLKHYKSFCRRGITISVHSFVYIMGEEMKRLIAYVEDLYEDTNSCNMVKVQWFGKADEVG
VLLPMDFDDREIFFSLGRQDLNVVCIDGLAAVLSAQHYEKFKSDTRYSLWQPYFCYRQID
NGEAKPFDVTQLQGYWSQEVLRTMFNATSCLKVRFKVPKSGPNSDGGLKRKRDAFNNDAN
RQKFICSGAFTSRFYGENIEHLCPGCHVEVLSQDSGIKIKSRVRYLELQDADETGNLEEW
VLLTRIAKPDQLGVRFLGRPMVRPQHVEESKASCFDVGAIVDAWWHGGWWEGIVLCQGGR
GRLQVYFPGEKRITEFGEDELRYSLEWVGNKWNPLKGRKDIAHKLTSTADRGSEYLIGKQ
DHLNFDVLLKPEPQLEGLQYDKRGIEKSSVTTISRDQKRVLADLTNDLKLDSLRWRPRKR
SRRSGSRKQSDTSSGSSSGDMDLSSPGPSGFCQLNLVPDDETCKSSGEQPFMGVPVQAPK
SDCLPLHAPKFRAYAIQPTDQPSMRGETSAFSVVRALATASLVAEPSSRRASSSLATKLG
EKRSWVGGSGGGPLRALRSEEEGRVKRATEVAAVEAVPRRRIAIAKCLRCPPPSFKVVGD
KRKRSSSPPSSSSSIRSSALDLSRERYDLRFRLRICSIQFALYFVRFF*

MDEAATAALAAARGRWTQWEEVVVSNDRGSRLVHYYLRGNSEEKQLAVVGRERSPRHMSY
AVQGRFLRALAAAAGAVAVAPSPSRSPLPAAGADGGAPRRWRSRREVVDWLSSLVSGHNY
GSSSMATRCSRDSYDDSVNNCTQVTASKDVSSREPSNVFTWLGAPCYCPQRLKHYKSFCR
RGITISVHSFVFIMSEEMKRLIAYVEDLYEDTNSCNMVKVQWFDKVDEVGVPLPMDFDDR
EIFFSLGRQDLNVECIDGLAAVLSVQHYEKFKGDTRYNLWQPYFCCRQIDNGDIKPFDVT
QLQGYWSQEVLRTMFNATSSLKVRFKVPKSRPSSDGGLKRKRDAFNDDANPQKFISSGAS
TSRFYGENIQQLCPGCHVEVLSQDSGIRGCWFRCLILKRHKDKIKVRYLELQDADETGNL
EEWVMLTRVAKPDQLGVRFLGRPMVRPQRVEQSKASCFDVGAIVDAWWHGGWWEGIVLYQ
VGSGRLQVYFPGEKRTAEFGEDELRCSLEWVGNKWNPLKGRKDVTSKLTSTADCGSEYLI
AKQDPLNFHVPKNSEPQLEGHQYDKRGIEKSSVSTISRDQKRVLADLTNDLKLDNLRWRP
RKRSRRSGSRKQSDTSSGSSSGDMDLFSPSPSGSFGQHNLVPDEETCKSSGEQTFMGVPV
QVPNLVMSR*

Other information
Ka divergence:-0.0762013KaKs divergence:0.103719
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):2667Length 2 (bp):2010Length divergence:-0.14
MFE 1 (kcal):-1023.68MFE 2 (kcal):-750.7MFE divergence-0.154