Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC220972.3-GRMZM2G004519
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2306630278758
Log2 mRNA fold difference:-0.36737530420906
Log2 TE fold difference:-1.0202532734411
Sequences
Protein sequence

MGVSDGDGNGNGPKASEEAVSCEGSPEYRLPFSKPHVPSPPQVTDPTNYAMTGKILLAAA
GAFAGVLLALVALHLYNSTRRRRLGGNQRRLFRSLAIAGGDEDRRDGDGEGAPPPHRGLD
SAVLAAIPVVLIEAGADAGGGDCAVCLAELEPGEKARALPRCGHRFHIECIGAWFRGNAT
CPLCRADVVVVAPGAIVPAEGGALSEEVRIDVAGDAVAATPNGSTVVPVMGRLHSGRDLE
KARRVFASTRFSSF*

MGAGDGNGTRPKANEVTISCDEGPGHAFPFPKPHAPDPDPPQASDPANYAVAGKILLAAA
GAFAGVLLALVALHLYSSTRRRRLGAGQPRLLRSLAIAGGDEDRRDGDGDGAGAPSPRGL
DYAVLAAIPVVSIEAGAGAGDCAVCLAELESGEKARALPRCGHRFHVECIDAWFRGNATC
PLCRADVVVPPSATAPAEGGAQPEVRIDVAGDAVAAPPNGFRVAPVMGRMHSDQDLEKAR
RVFASTRFSSF*

Other information
Ka divergence:-0.190123KaKs divergence:0.074571
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):765Length 2 (bp):756Length divergence:-0.006
MFE 1 (kcal):-395.92MFE 2 (kcal):-413.7MFE divergence0.022