Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC225147.4-GRMZM2G110952
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100192600

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDMAPAAVSSNPRSVEEIFKDFSGRRAGLVRALTSDVDDFCSFCDPDKENLCLYGLPNGS
WEVSPPADEVPPELPEPALGINFARDGMQRRDWLSLVAVHSDSWLISVAFFYGARLNAND
RKRLFSMISDLPSVFEAFADRKHVRDRSGVDSSGKSRHSSKRGNDGHAKNSRAAAPAAKE
YDDDDDEEDEEHTETFCGSCGGLYNANEFWIGCDICERWFHGKCVRITPAKADHIKHYKC
PDCSSKKIRQ*

MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKRTTFFYPVANPGELAKQCKSGNRDLIAERQNRRLGPVPYRIPIIARSAAYPAAPARS
TPPAPTSARRMDMAPASVYFNPRSVEEIFKDFSGRRAGLVRALTSDVDDFCRLCDPDKEN
LCLYGLPNGSWEVSPPAEEVPPELPEPALGINFARDGMQRRDWLTLVAVHSDSWLISVAF
FYGARLNGNDRKRLFSMMSDLPSVLEAFADRKHGRDRSGVDSSGKSRHSSKRGKDGHAKS
FRAAAPAAKEYDEDDDEEDEEEHTETFCGSCGGLYNASEFWIGCDICERWFHGKCVRITP
AKADHIKHYKCPDCSSKKMRQIYDAVIKTGTESNAGKAALDALGAELTTPLVADVLHRLR
YEEKLAFRFFAWASQQDGYNHEPTTYNDIIDILSGTRYKSRQFGVLCNVLDHMKRHGSRS
VPVEDLLEILRAYTEKHLTHMRKLAKKRRVRMRTPPETDALNVLLDAFCKCGMVKEAEAV
FGRVKRKLLGNAETYSTLFFGWCRARDPKKAMKVLEEMIQMKHTPESFTYVAAIISFCSA
GLVSEARELFEFMRTEGLTISSPTAKTYSIMIVALAKADRMEECFELLSDMRSCGCMPDV
TTYKDLIEGMCLVGKLDAAYRVLDEMGRAGFPPDIVTHRKADDALELCERMIEAHCEPSV
HTYNMMMMMFFEMGEAHRALDICLEMDKRRCQRAIDTYEIMIYGLFDCGETEYATALLDE
VINRDMKLSYKKFDAIMLRSLFKAIRGKYIKKCALNCGLDMDQKADEAILEVLDLRCFDS
VQEVDILAYYTLSGELKYQFGSGRIQGKVEYMAYKKMEYKKFLRMFGATKRPECQVAEPA
LNQKEEVMIEYRPPAPAVHSRPAPQWICPVSFIELSKTTFPSPLVYACCGGFYLQDWSLA
WYGSMFVYPLCRKYLMLHVFSMALVSQILSTIGSILVKPTMRRPGSTIRWSNSVRLKSPK
LIFRILKEEDVGARACLKLRPVSVLMQLITCGSLSVKDHGNAGVVQMCKPRFPNLRLLPS
PLISRTMMMGELDCLSENPKLMGIKL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):60GC content 2 (%):53GC content divergence:-0.062
Length 1 (bp):753Length 2 (bp):3501Length divergence:0.646
MFE 1 (kcal):-311.41MFE 2 (kcal):-1326.23MFE divergence0.62