Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC226235.2-GRMZM2G079034
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100277961

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.6793660321481
Log2 mRNA fold difference:-1.5114966486626
Log2 TE fold difference:5.1800547519621
Sequences
Protein sequence

MADDQQPPAQRYWFPYWTAPAPRPVARPQLSRRETRPAPSPSPPATASPSRRPSHPQQAA
TPASRSAGSGVPDPPAQPQPTRLSSRPSPSPSRVPPLSPIREPNARAPVPSPAPVAKEHK
QPSPLHHTEHGVPKQKDITVPQEKTIHKPLVASKTQTKTPEKEKDKEKGKEKEKEGSQLH
KEKDKEKKDKEKEKEKDKEKEDHKDKKDKDHKEKKEKNKEKEGSQLHKELKAGVADMVHT
LSSSAPSSGGGHERAGSAAAGTTIITLAGENKGTSMKVDSSAVAYGTADAAGSKERRGHK
LDGSVIVSGKEQAGAGKGLTAFVNSNVQVINNSLLLQSSCHGGDLGVHLKLSTKAKKKDG
KEAGGNSGSAAAPKK*

MADDQQPPTQRIWFPYWTAPAPAHGPRPAARPQLSRRESRPAPQASPPPTTASTGAGGGV
PAPPAQPTPLSSRPSPPPARAPPLSPIGEPNARAPEPSPVPVAKQHRPPSPLRPNYIARD
VPKQKDIVVPQEKTIQEPALVASKTPAKAPEKEKEDKEKREEEKTKEKDKGHKMKKEKDH
EEKQEKDKEKEGGQPHKELKAGVADMVRKLGTPAPSSGGGHERAGSAAAEGTTIITLAGE
NKGASMKVDGSAVADGRADAAGSKERRGRTLDGSAVVSGTERAWGGRGFTAFVNSNVQVI
NNSLLLQSSCNGGGPGVHLKLSTKAKKKDGEGAGGKSGSAAAPKK*

Other information
Ka divergence:0.118824KaKs divergence:0.323591
GC content 1 (%):60GC content 2 (%):66GC content divergence:0.048
Length 1 (bp):1128Length 2 (bp):1038Length divergence:-0.042
MFE 1 (kcal):-449.65MFE 2 (kcal):-474.5MFE divergence0.027