Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC226320.1-GRMZM2G700926
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):LOC100280512

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.064916357952835
Log2 mRNA fold difference:3.4391972095126
Log2 TE fold difference:-3.6145898875209
Sequences
Protein sequence

QEEFEALCFEFGIELDDVTTEKAIIRKEKHLEDDSEVDEDDEVIYKIEVAANRYDLLCLE
GLARALRVFTGTEASPVFQVSSIPRGSMLQMHVKPENGIFMVLFLQCNP*

MPTVSVGRDRLLAAIGRTYTQEEFEALCFEFGIELDDVTTEKAIIRKEKHLEDDSEVDED
DEVIYKIEVAANRYDLLCLEGLARALRVFTGTEASPVFQVSSIPRGSMLQMHVKPETSKI
RPYIVCAVLRGVTFDEARYNSFIDLQDKLHQNICRKRTLVAIGTHDLDTLQGPFSYEALP
PNEINFVPLKQEKSFRADKLMEFYKSDMKLKKFLHIIENSPVYPVIYDSNRTVLSLPPII
NGAHSAITLATRNVFIECTATDLTKANIVLNTMVTMFSEYCETKFEVEPVEVIHHDGRKT
VYPDLSCYKMDVLLSDILGPIGISQDEKQVVCLLNKMQLQAESHSLKGEARISVSVPPTR
SDILHARDLSEDVAIAYGFNNVPKSKPKCMTIGGRQPLNRFSDKIRAEVARAGYMEVLTF
ILSSHEENFDMLNRTDDKSKAVIIANPRTSEFEVVRTSLMSCLLKTLKHNIDHPRPIKIF
EVGDVVMLDSSRDVGASNNRRLAALYCNRVSGFEEIMGLVDSIVKVVRAPHVNFGENYYV
PTDEPEFFPKRQCKIVTSDGKQVGYLGIVHAEVLRKFGIPDPCTFVEMDLEALL*

Other information
Ka divergence:-1KaKs divergence:0.999165
GC content 1 (%):48GC content 2 (%):42GC content divergence:-0.067
Length 1 (bp):330Length 2 (bp):1785Length divergence:0.688
MFE 1 (kcal):-110.9MFE 2 (kcal):-527.8MFE divergence0.653