Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC234165.1-GRMZM2G175406
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382423

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.1165096781173
Log2 mRNA fold difference:-0.30885198180587
Log2 TE fold difference:-1.6685270216175
Sequences
Protein sequence

MHSLVRRGNGYGYGYGGYGSSNPHMNYHRQNTESVTTVVTEMNRMAVDDKPCYGGGVQKQ
ACKVEAFQEHDEAYKGAVAVQQKHSSFKEDKEEVRGAAAAVRSWHDELYKEEEEEKRVVD
TEYGARYGGVAAVKKPGYNYKQHEAYGETEGAGYGYGAGGVKKQAGYSYAQEACGESYGG
AHHGGAGAVAQTYAYDQQQAYKHKNAAGAGAGYGAPYGGGAVQQHDGHKDVYRHGAAAGG
KVKKNGYQYQEAYGGTDAGGYGAHYGGGGGAVQQYGYGGATTDGKVKKGGHQYYGGSGAG
GYDSHYGGGGGGAVQQYGGYHKDAYGYGGGATAGGKAKKSGYQYEEAYAGTGAGGYGAHY
GGGAAVAQKQGYRQGIYESESESESESESDESDCEEAFLPHGGRTPQGGVQHSYGYGGGA
YKHGAGNLGGLRRYQSYESREDLGGGRRYETYQSTVQYTGSPTKNRHVLRYGA*

MDSLVKRSNGYGAYGSSKPQMSYHRQSTESVTTVVTEINRMTINDKPYYGGGGVQKQACK
VEAFDEHDKAYNGTLAVKKHDEYEEEEEYGQVVDADYGAHYGNAGAAVKKQGYSYQQEAY
GETGAAGYGGAAMKKQGYNYTKEACGESDAGYGAHHGGAGAAVQTYAYNQQALYGGSIGA
AVQQPAYKQKGAASKTNGSRQKVYGYGEAVNTAGAGYGAHHGVVGAGAGQQHGYHQKDAY
GTGYGAVAVVGKEKNGYQYQEAYGGTDAGGYGGAHYGGGGAVQQHGYGGVTAGGKVKQSG
YQYQEAAYGGTDAGGYGAHYGGGAAAAIQKHGYRKDVYESETESEDDESDCEEAFPPRGG
RMQGGVQVQHGYGADNLGGVRRYESYESREEHGDGRRYESYKSTVQYNGGGHATCSPIKN
RHLLGYGA*

Other information
Ka divergence:-0.282341KaKs divergence:-0.175828
GC content 1 (%):66GC content 2 (%):65GC content divergence:-0.008
Length 1 (bp):1422Length 2 (bp):1287Length divergence:-0.05
MFE 1 (kcal):-680.16MFE 2 (kcal):-586.83MFE divergence-0.074