Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC234526.1-GRMZM2G078480
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.832671537416
Log2 mRNA fold difference:1.6499842152118
Log2 TE fold difference:0.12796402841549
Sequences
Protein sequence

MASPPPPRVCVTGGGGYVASWLVKLLLSRGYAVHATVRDPSDPKNAHLQQLDGARERLRL
FKADVLDRDALATAVVACEGVFHVASPVPADKSEVLSPAVKGTLNVLQACSANNVQKVVV
VSSTAAVYFNPSWPQGRTKDESCWSDRDLCIKNENWYCAAKTIAEETAVEYGEKNGLIVV
TVCPCIVLGPLLQPLINASSELLVYIIKGGFYIFLLVSNIHWLDNYSHGGPRVLKNLPWN
IVDVRDVADALLLVYEKVESSGRYICAPNRISTNNMVNLFKKSYPNYNYVNCDNKDYESE
ISPVTSEKLKSLGWNPRTMEKTLLDNIEYFEKAGFLRDGEGYPCRLPHIFHFASD*

MASPRVCVTGGGGYVASWLVKLLLSRGYAVHATVRDPSDPKNAHLRRMEGASESLLLFKA
DMLDRDALAAAVSGCEGVFHVASPVPADKVLDPEAEVLSPAVKGTLNVLQACSANNVRKV
IVVSSTAAVHFNPSWPQGIIQDESCWSDKFFCTKSEEWYIAAKTIAEETALEYGEKNGLL
VVTVCPCVVLGPLLQPLINTTSEVFVYIIKGGPRAMKNITWNIVDVRDVADALLLVYEKV
ESSGRYICAPNRISTYDIANLFRKFYPNYNYVKCSDEDHESEMPPVTSEKLKSLGWKPRK
LEETLLDSIEHYEKAGFLQDVEGCPCRLPYLFHFASN*

www.000webhost.com

Other information
Ka divergence:0.0143022KaKs divergence:0.352123
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):1068Length 2 (bp):1014Length divergence:-0.026
MFE 1 (kcal):-373.15MFE 2 (kcal):-349.29MFE divergence-0.033