Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC234528.1-GRMZM2G002704
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):gibberellin 20 oxidase 2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASFAPSGEVSSKHGVVGYGIVGGPNGNAVAPAAKSTVVETTIERFAYASSVPRLLLLQI
NEVSKEYFLKTVSNIVGDKLLKQAASQYQMQAQRSPQTNPSNYSLSGQVSGQQTAPSGSV
TGDEQKGYPWAHTIPMRQAIASTRPPQFRPSSSGQMRSNTGNPPSQTNLHKANKMGNMSD
GKGVHMLQTHPPNNSIPVQTMQHHVQRPQTSSPVFGANSIHARPFLRPVGGPAAPFRPQM
ADSNPRAHLIQGAVTTISRSVPKRSIVSGNAPVNQALGSSKVSAGMESQSQQLSAPKPLA
ATSLSQTQSHGIQEEPKIQGKKQLLFESLPATDLKYWSLERKLCQPLLITEKMFAYRETV
LEEAHQGMELHEHCRHIVDNDDQHCRFHSLCVHQVGLRNTEQQQQYRKESAYVGQMEATQ
PLVAPPFQQWPPTGAVLPLPGSTASVTNPPSPPIPGASDIVAADEVCTIFMDLPIDVKET
EMHNLLCWLLGFEAFEMNFKGNQPMGFALFSTVHQAITAKAMFQDTVFDTETKVVLQTDM
AKKNLFVKRSNQLDLVKGGFIANVQCEEDVDDDGAERGHSKAMPEVTTRVINREEVIVDG
LRDNVFAFSENVPGTTTKGIMDTVLVTQYFGTMRLGPPRSHLVHPPWSWSCQGCLGIDKR
WLPAC*

MSLVAAPMAIVDVANAQLQQAAAAAAKKDEDGHEQQESSYDYGALMKGVRHLSDSGITRL
PDRYVLPASDRPGVLAVSSSVAGSGRVKLPVVNLAGLRDPCQRAAVLATLDAACREYGFF
QVVNHGFGSDVSGGMLDVAQRFFELPLAERARHMSADVRAPVRYGTSFNQAKDDVLCWRD
FLKLVCQPLQAVLPYWPQQPADLRDVATRYATASHRLFMEVMEAALEALGIPTAGGVLGE
LAASSSHMMTVNCYPACPQPELTLGMPSHSDYGLFTFVLQDHVEGLQVMHDGRWLTIDPI
PGSFVVNVGDHLEIYSNGRYKSALHRVHVNSTRPRISVASFHSLPAERVIGPAPELVDDE
AGNPRRYMDTDFATFLAYLASADGKNKTFLQSRKLPAAAPPCL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):68GC content divergence:0.153
Length 1 (bp):1998Length 2 (bp):1212Length divergence:-0.245
MFE 1 (kcal):-677.3MFE 2 (kcal):-610.1MFE divergence-0.052