Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AC235541.1-GRMZM2G159720
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191440

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.89182299974583
Log2 mRNA fold difference:-0.34511903983415
Log2 TE fold difference:1.2380039582823
Sequences
Protein sequence

MSEEYNMDVALKAKNVAETKFHARDIRGARKYALKAQNLCPTLEGILQMVSTLEVHLAAE
SKIDGESDWYRILCLGAFADEEEVRKQYRKLALLLHPDKNKSVGAEEAFKLISEAWSVLS
DTSRKVVYDEKRRNHSVVNVTNGIYTYDKKANKRARKNAAAAAAAAAAAAAAEATTRPVG
IDTFWTSCNRCRMQYEYLRIYLNHNLLCPNCHNAFLAVETGFPCNGSSSSFSWSTKQQPQ
QNHNSTKHSYGSTSRTSSIPGTGNGGYQQDNTYDSYNNQGFQWNQYSKTTTAAVTNAYST
QALEKQRRKHDESYSYNYSESGNTYVHEKAASRRGRFSKRRRHNYDAYTTVDYGGDNKET
VAATASTEPTAVFTDVGRVNGTSVERFKSAVSGRRANILGEITQIDTRNLLLEKAKATVC
EKLHELNITPSSRAADRRGSEGKLYPCDNNIKVNGVLSDKPGKGVKLCNSRSMEIQVPAT
DDKNPEQRRVPVSIDVPDPDFHDFDKDRTEKAFDTDQVWATYDCEDGMPRLYVMVQKVLS
TRPFRIRMSFLNSKSNIELAPINWVASGFQKTCGDFRVGRYQVSETVNIFSHRVRWTKGP
RGIIRIVPQKGDTWALYRNWSPDWNELTPDDVIYKYEIVEVADDFTEERGLTVIPLLKVA
GFKAVFHRHVDPEEVRRIPKEELFRFSHRVPSRLLTGEEGSNAPKGCHELDPAATPVDLL
KVITEHKEDAVAQSPK*

MSEEYNMDDALKAKNVAETKFHARDIRGARKYALKAQNLCPTLEGILQMVSTLEVHLAAE
SKIDGESDWYRILSLGAFADEEEVKKQYRKLALLLHPDKNKSVGAEEAFKLISEAWSVLS
DTSRKVVYDEKRRNHSVVNVTNGIYTYDKKANKRARKNAAAAAAAAAAAAAAAETTTHPV
GVDTFWTSCNRCRMQYEYLRIYLNHNLLCPNCHNAFLAVETGFPCNGSSSSFSWSTKQQP
QQNHNSTKHSYGSTSRTSSIPGTGHGGYQQDNAYDSYNNQGFQWNQYSKTTPAAGTNAYG
THALEKQRKKHDESYSYNYSESGNLYVHEKAASRRGRFSKRRRHNYDTYTTVDFGGDNKE
TVAASTEPTAVFTDVGRVNGTSAERFRSAVSGRRANVLGEITQIDTRSLLLEKAKATVRK
KLQELNITSSSRFAERRGSEGKLNPCGNNIKVNGVLSDKPGKGVKLCSSRSIEIQVPDTD
DKNPEQRRVPVSIDVPDPDFHDFDKDRTEKAFDSDQVWATYDSEDGMPRLYVMVQKVLSM
RPFRIRMSFLNSKSNIELAPISWVASGFQKTCGDFRVGRYQVSETVNIFSHRVSWTKGPR
GVIRIVPQKGDTWALYRNWSPDWNELTPDDVIYKYEIVEVVDDFTEEQGLTVIPLLKVAG
FKAVFHRHMDPKEVRRIPKEGLFQFSHRVPSRLLTGEEGNNAPKGCHELDPAATPVDLLK
VITELKEDAVGADC*

Other information
Ka divergence:0.0410607KaKs divergence:0.325183
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2211Length 2 (bp):2205Length divergence:-0.001
MFE 1 (kcal):-751.54MFE 2 (kcal):-736.8MFE divergence-0.01