Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01020-AT4G01510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Arv1-like protein
Function (paralog2):Arv1-like protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.29929698556267
Log2 mRNA fold difference:-0.23669435011229
Log2 TE fold difference:0.5683573963906
Sequences
Protein sequence

MAASEHRCVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIECERMIIFIDLILHRPK
VYRHVLYNAINPATVNIQHLLWKLVFAYLLLDCYRSLLLRKSDEESSFSDSPVLLSIKVL
IGVLSANAAFIISFAIATKGLLNEVSRRREIMLGIFISSYFKIFLLAMLVWEFPMSVIFF
VDILLLTSNSMALKVMTESTMTRCIAVCLIAHLIRFLVGQIFEPTIFLIQIGSLLQYMSY
FFRIV

MAREKKTCVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECELLIIFIDLILHKTK
AYRHLLYNVVNQESANVQHLLWKLVLAYLLLDTYRSLLLRRTNDGSNVSMSFLFESLEVL
VNVLSANFAFVFSFAFAAKLMLVMPRGKEILLTILISSYVKIFLFAMPVWEFPVSVIFIV
DMLVLTSNAVALKVMTESATSRCLAVCFIAHSIRFLVDQISGHLGSVM

www.000webhost.com

Other information
Ka divergence:-0.029983KaKs divergence:-0.552816
GC content 1 (%):38GC content 2 (%):38GC content divergence:0
Length 1 (bp):738Length 2 (bp):687Length divergence:-0.036
MFE 1 (kcal):-185.7MFE 2 (kcal):-191.04MFE divergence0.014