Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01050-AT4G01480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):pyrophosphorylase 1
Function (paralog2):pyrophosphorylase 5

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.35339906913888
Log2 mRNA fold difference:-0.9567512662777
Log2 TE fold difference:1.306607065546
Sequences
Protein sequence

MSEETKDNQRLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK
VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA
RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV
AVNDFLPSESAVEAIQYSMDLYAEYILHTLRR

MNGEEVKTSQPQKKLQNPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEIS
KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGC
FLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHITNINELPPHRLSEIRRFFEDYKKNE
NKEVAVNDFLQPGPAIEAIQYSMDLYAEYILHTLRR

www.000webhost.com

Other information
Ka divergence:0.693345KaKs divergence:0.622351
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):639Length 2 (bp):651Length divergence:0.009
MFE 1 (kcal):-183.19MFE 2 (kcal):-188.93MFE divergence0.015