Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01100-AT4G00810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):60S acidic ribosomal protein family
Function (paralog2):60S acidic ribosomal protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9152795245018
Log2 mRNA fold difference:-1.4893756224789
Log2 TE fold difference:-0.40222041537789
Sequences
Protein sequence

MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPMLFAKMAEKRNVTDLI
MNVGAGGGGGAPVAAAAPAAGGGAAAAPAAEEKKKDEPAEESDGDLGFGLFD

MSTVGELACSYAVMILEDEGIAITSDKIATLVKAAGVEIESYWPMLFAKMAEKRNVTDLI
MNVGAGGGGGGAPVSAAAPAAAGGAAAAAPAKEEKKDEPAEESDGDLGFGLFD

Other information
Ka divergence:-0.0864198KaKs divergence:-0.717842
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):339Length 2 (bp):342Length divergence:0.004
MFE 1 (kcal):-125.4MFE 2 (kcal):-113.5MFE divergence-0.05