Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01110-AT4G00820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):IQ-domain 18
Function (paralog2):IQ-domain 17

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.38938130568766
Log2 mRNA fold difference:-0.93067355196118
Log2 TE fold difference:0.41808613467524
Sequences
Protein sequence

MGKKNGSSSWLTAVKRAFRSPTKKDHSNDVEEDEEKKREKRRWFRKPATQESPVKSSGIS
PPAPQEDSLNVNSKPSPETAPSYATTTPPSNAGKPPSAVVPIATSASKTLAPRRIYYARE
NYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVL
DQRKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSMSREGSSAAEDWDDRPHTIDAVKV
MLQRRRDTALRHDKTNLSQAFSQKMWRTVGNQSTEGHHEVELEEERPKWLDRWMATRPWD
KRASSRASVDQRVSVKTVEIDTSQPYSRTGAGSPSRGQRPSSPSRTSHHYQSRNNFSATP
SPAKSRPILIRSASPRCQRDPREDRDRAAYSYTSNTPSLRSNYSFTARSGCSISTTMVNN
ASLLPNYMASTESAKARIRSHSAPRQRPSTPERDRAGLVKKRLSYPVPPPAEYEDNNSLR
SPSFKSVAGSHFGGMLEQQSNYSSCCTESNGVEISPASTSDFRNWLR

MGKKSGSSSSWLTAVKRAFRSPTKKEHNNNAHGNEVDEDEDKKKEKRRWLFRKSTNHDSP
VKTSGVGKDAPAQKSTETTTIINPTVLSSVTEQRYDASTPPATVSAASETHPPSTTKELP
NLTRRTYTAREDYAAVVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCM
QALVRVQSRVLDQRKRLSHDGSRKSAFSDTQSVLESRYLQEISDRRSMSREGSSIAEDWD
DRPHTIEEVKAMLQQRRDNALRRESNNSISQAFSHQVRRTRGSYSTGDEYEEERPKWLDR
WMASKPWDKRASTDQRVPPVYKTVEIDTSQPYLTRGNSRTGASPSRSQRPSSPSRTSHHY
QQHNFSSATPSPAKSRPIQIRSASPRIQRDDRSAYNYTSNTPSLRSNYSFTARSGYSVCT
TTTTATNAALPNYMAITESAKARIRSQSAPRQRPSTPEKERISSARKRLSFPVPPLPQQM
DGQSLRSPSFKSIGGSQLGALEQQSNYSSCCTESLGGGGEISPASTSDYRRWLR

www.000webhost.com

Other information
Ka divergence:-0.231062KaKs divergence:-0.145588
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1584Length 2 (bp):1605Length divergence:0.007
MFE 1 (kcal):-505.04MFE 2 (kcal):-475.63MFE divergence-0.03