Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01160-AT4G00850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GRF1-interacting factor 2
Function (paralog2):GRF1-interacting factor 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5460066399031
Log2 mRNA fold difference:-1.0055630050685
Log2 TE fold difference:-0.55907888785657
Sequences
Protein sequence

MQQQQSPQMFPMVPSIPPANNITTEQIQKMLGGSGNFESGFQEWTLKLDACLMLLFCTFS
WLDYLDENKKLIMAIMENQNLGKLAECAQYQALLQKNLMYLAAIADAQPPPPTPGPSPST
AVAAQMATPHSGMQPPSYFMQHPQASPAGIFAPRGPLQFGSPLQFQDPQQQQQIHQQAMQ
GHMGIRPMGMTNNGMQHAMQQPETGLGGNVGLRGGKQDGADGQGKDDGK

MQQSPQMIPMVLPSFPPTNNITTEQIQKYLDENKKLIMAILENQNLGKLAECAQYQALLQ
KNLMYLAAIADAQPQPPAATLTSGAMTPQAMAPNPSSMQPPPSYFMQQHQAVGMAQQIPP
GIFPPRGPLQFGSPHQFLDPQQQLHQQAMQGHMGIRPMGLNNNNGLQHQMHHHETALAAN
NAGPNDASGGGKPDGTNMSQSGADGQGGSAARHGGGDAKTEGK

www.000webhost.com

Other information
Ka divergence:-0.029767KaKs divergence:0.999889
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):690Length 2 (bp):672Length divergence:-0.013
MFE 1 (kcal):-205.1MFE 2 (kcal):-218.8MFE divergence0.032