Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01170-AT4G00860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1138)
Function (paralog2):Protein of unknown function (DUF1138)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.52045536067018
Log2 mRNA fold difference:-0.49380116885519
Log2 TE fold difference:0.99421504707932
Sequences
Protein sequence

MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNKEWWAATDEKFQAWPR
TAGPPVVMNPISRQNFIVKTRPE

MSRATYIIGALAGSAVVAYVCDKVISDDKLFGGTTPGTITNKEWGAATEERLQAWPRVAG
PPVVMNPISRQNFIVKSRPE

Other information
Ka divergence:0.563694KaKs divergence:0.751019
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):252Length 2 (bp):243Length divergence:-0.018
MFE 1 (kcal):-60.66MFE 2 (kcal):-62.86MFE divergence0.018