Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01340-AT4G01010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cyclic nucleotide gated channel 10
Function (paralog2):cyclic nucleotide-gated channel 13

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.043191189472
Log2 mRNA fold difference:-0.47672455391705
Log2 TE fold difference:-0.51752924418102
Sequences
Protein sequence

MAFSHDNRVRFKDEGKPLSSEYGYGRKARPSLDRVFKNVKWGFKKPLSFPSHKDPDHKET
SSVTRKNIINPQDSFLQNWNKIFLFACVVALAIDPLFFYIPIVDSARHCLTLDSKLEIAA
SLLRTLIDAFYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYLSSYFIIDLLSIL
PLPQIVVLAVIPSVNQPVSLLTKDYLKFSIIAQYVPRILRMYPLYTEVTRTSGIVTETAW
AGAAWNLSLYMLASHVFGALWYLISVEREDRCWQEACEKTKGCNMKFLYCENDRNVSNNF
LTTSCPFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWKKFFYCFWWGLRNLSALGQNL
QTSKFVGEIIFAISICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRML
PEDLRKRIRRYEQYRWQETRGVEEETLLRNLPKDLRRDIKRHLCLDLLKKVPLFEIMDEQ
LLDAVCDRLRPVLYTENSYVIREGDPVGEMLFVMRGRLVSATTNGGRSGFFNAVNLKASD
FCGEDLLPWALDPQSSSHFPISTRTVQALTEVEAFALTAEDLKSVASQFRRLHSKQLQHT
FRFYSVQWRTWSVSFIQAAWRRYCRRKLAKSLRDEEDRLREALASQDKEHNAATVSSSLS
LGGALYASRFASNALHNLRHNISNLPPRYTLPLLPQKPTEPDFTANHTTDP

MAFGRNNRVRFRDWISEGTEYGYGRNKARPSLNTVLKNVRRGLKKPLSFGSHNKKRDSNS
STTTQKNIINPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHRNLEIAA
SVLRTFIDAFYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDLLSIL
PLPQLVVLAVIPNVNKPVSLITKDYLITVIFTQYIPRILRIYPLYTEVTRTSGIVTETAW
AGAAWNLSLYMLASHVFGALWYLISVEREDRCWREACEKIPEVCNFRFLYCDGNSSVRND
FLTTSCPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQN
LNTSKFVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRM
LPDDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDE
QLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPS
DFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQH
TFRFYSVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAITKRERNAASSSSLVAT
LYASRFASNALRNLRTNNLPLLPPKPSEPDFSLRNP

www.000webhost.com

Other information
Ka divergence:-0.0681392KaKs divergence:-0.463221
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2136Length 2 (bp):2091Length divergence:-0.011
MFE 1 (kcal):-628.4MFE 2 (kcal):-584.24MFE divergence-0.036