Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01360-AT4G01026
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):regulatory component of ABA receptor 1
Function (paralog2):PYR1-like 7

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4382692497629
Log2 mRNA fold difference:0.27926357943859
Log2 TE fold difference:0.99591405045885
Sequences
Protein sequence

MMDGVEGGTAMYGGLETVQYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQ
KYKPFVSRCTVIGDPEIGSLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLK
NYSSILTVHPEIIEGRAGTMVIESFVVDVPQGNTKDETCYFVEALIRCNLKSLADVSERL
ASQDITQ

MEMIGGDDTDTEMYGALVTAQSLRLRHLHHCRENQCTSVLVKYIQAPVHLVWSLVRRFDQ
PQKYKPFISRCTVNGDPEIGCLREVNVKSGLPATTSTERLEQLDDEEHILGINIIGGDHR
LKNYSSILTVHPEMIDGRSGTMVMESFVVDVPQGNTKDDTCYFVESLIKCNLKSLACVSE
RLAAQDITNSIATFCNASNGYREKNHTETNL

www.000webhost.com

Other information
Ka divergence:0.314541KaKs divergence:0.121289
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):564Length 2 (bp):636Length divergence:0.06
MFE 1 (kcal):-157.19MFE 2 (kcal):-183.57MFE divergence0.077