Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01390-AT1G01420
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-glucosyl transferase 72B3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.5778396922371
Log2 mRNA fold difference:1.7770749432006
Log2 TE fold difference:-1.0935405650876
Sequences
Protein sequence

MAEANTPHIAIMPSPGMGHLIPFVELAKRLVQHDCFTVTMIISGETSPSKAQRSVLNSLP
SSIASVFLPPADLSDVPSTARIETRAMLTMTRSNPALRELFGSLSTKKSLPAVLVVDMFG
ADAFDVAVDFHVSPYIFYASNANVLSFFLHLPKLDKTVSCEFRYLTEPLKIPGCVPITGK
DFLDTVQDRNDDAYKLLLHNTKRYKEAKGILVNSFVDLESNAIKALQEPAPDKPTVYPIG
PLVNTSSSNVNLEDKFGCLSWLDNQPFGSVLYISFGSGGTLTCEQFNELAIGLAESGKRF
IWVIRSPSEIVSSSYFNPHSETDPFSFLPIGFLDRTKEKGLVVPSWAPQVQILAHPSTCG
FLTHCGWNSTLESIVNGVPLIAWPLFAEQKMNTLLLVEDVGAALRIHAGEDGIVRREEVV
RVVKALMEGEEGKAIGNKVKELKEGVVRVLGDDGLSSKSFGEVLLKWKTHQRDINQETSH

MADGNTPHVAIIPSPGIGHLIPLVELAKRLLDNHGFTVTFIIPGDSPPSKAQRSVLNSLP
SSIASVFLPPADLSDVPSTARIETRISLTVTRSNPALRELFGSLSAEKRLPAVLVVDLFG
TDAFDVAAEFHVSPYIFYASNANVLTFLLHLPKLDETVSCEFRELTEPVIIPGCVPITGK
DFVDPCQDRKDESYKWLLHNVKRFKEAEGILVNSFVDLEPNTIKIVQEPAPDKPPVYLIG
PLVNSGSHDADVNDEYKCLNWLDNQPFGSVLYVSFGSGGTLTFEQFIELALGLAESGKRF
LWVIRSPSGIASSSYFNPQSRNDPFSFLPQGFLDRTKEKGLVVGSWAPQAQILTHTSIGG
FLTHCGWNSSLESIVNGVPLIAWPLYAEQKMNALLLVDVGAALRARLGEDGVVGREEVAR
VVKGLIEGEEGNAVRKKMKELKEGSVRVLRDDGFSTKSLNEVSLKWKAHQRKIDQEQESF
L

www.000webhost.com

Other information
Ka divergence:-0.15631KaKs divergence:-0.643655
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1443Length 2 (bp):1446Length divergence:0.001
MFE 1 (kcal):-472.22MFE 2 (kcal):-478.1MFE divergence0.006