Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01390-AT4G01070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.2640814058594
Log2 mRNA fold difference:1.8965419679654
Log2 TE fold difference:-0.66846308399619
Sequences
Protein sequence

MAEANTPHIAIMPSPGMGHLIPFVELAKRLVQHDCFTVTMIISGETSPSKAQRSVLNSLP
SSIASVFLPPADLSDVPSTARIETRAMLTMTRSNPALRELFGSLSTKKSLPAVLVVDMFG
ADAFDVAVDFHVSPYIFYASNANVLSFFLHLPKLDKTVSCEFRYLTEPLKIPGCVPITGK
DFLDTVQDRNDDAYKLLLHNTKRYKEAKGILVNSFVDLESNAIKALQEPAPDKPTVYPIG
PLVNTSSSNVNLEDKFGCLSWLDNQPFGSVLYISFGSGGTLTCEQFNELAIGLAESGKRF
IWVIRSPSEIVSSSYFNPHSETDPFSFLPIGFLDRTKEKGLVVPSWAPQVQILAHPSTCG
FLTHCGWNSTLESIVNGVPLIAWPLFAEQKMNTLLLVEDVGAALRIHAGEDGIVRREEVV
RVVKALMEGEEGKAIGNKVKELKEGVVRVLGDDGLSSKSFGEVLLKWKTHQRDINQETSH

MEESKTPHVAIIPSPGMGHLIPLVEFAKRLVHLHGLTVTFVIAGEGPPSKAQRTVLDSLP
SSISSVFLPPVDLTDLSSSTRIESRISLTVTRSNPELRKVFDSFVEGGRLPTALVVDLFG
TDAFDVAVEFHVPPYIFYPTTANVLSFFLHLPKLDETVSCEFRELTEPLMLPGCVPVAGK
DFLDPAQDRKDDAYKWLLHNTKRYKEAEGILVNTFFELEPNAIKALQEPGLDKPPVYPVG
PLVNIGKQEAKQTEESECLKWLDNQPLGSVLYVSFGSGGTLTCEQLNELALGLADSEQRF
LWVIRSPSGIANSSYFDSHSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLAHPSTGG
FLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVA
RVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAHKKELEQNGNH

www.000webhost.com

Other information
Ka divergence:-0.189547KaKs divergence:-0.781486
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1443Length 2 (bp):1443Length divergence:0
MFE 1 (kcal):-472.22MFE 2 (kcal):-501.96MFE divergence0.031