Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01430-AT4G01080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TRICHOME BIREFRINGENCE-LIKE 25
Function (paralog2):TRICHOME BIREFRINGENCE-LIKE 26

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.20864942211693
Log2 mRNA fold difference:-0.63138077605848
Log2 TE fold difference:0.62400497517814
Sequences
Protein sequence

MDSLRLISKSIKIEGTPFGSSHQRNQIFLKSVAFFLLIGLAYRFLITNSTVSPVPTVRSS
PESLPPDPSGLTAITQTSASVDSPANITTIASQNVSTKCDIFIGNWVPDPSGPIYTNVSC
RHIQDYQNCLKNGRPDVNYLRWRWQPRDCDLPRFNPEQFLDNMRNKWLAFIGDSISRNHV
QSLLCILSQVEEVEDIFHDKEYKSRIWRFPSYNFTLSVIWSPFLVKAETFENGVPFSDIR
VHLDKLDQKWTDQYINFDYVVISGGKWFLKTTIFHENNTVTGCHYCQGKNNMTELGYLYS
YRKVLHLVLDFVAEPNHKAQVLFRTTTPDHFENGEWDSGGFCNRTMPFTEGSEGEMKSED
VSMRDIELEEFYKTTTTQQEGSNSNIVLLDTTSMSLLRPDGHPGPYRYPNPFAGLKNKEL
NQVQNDCLHWCLPGPIDSWNDLMVEVMLNRERQRRE

MEQQLTLVLLDSPKGAKYVETFEEAASSSSSSSSSSVPSCTDHRHRTFVKFFLYFSLVAL
AYYFIISSLAVSPIPPTLPQSSPGNVSSAKCDLFTGDWIPDPTGPLYTNVTCRHIQDFQN
CLLNGRPDVNYLFWRWKPRDCDLPRFSPSQFLASVKNKWWAFIGDSIARNHVQSLICILS
QVEEVEEIYHDKEFRSKIWRFPSHNFTLSVIWSPFLLKSETSSNSDIQLYLDQLDHKWTV
QYPKFDYVVISGGKWFLKTTIFHENNVVTGCHYCQGRNNLTDLGYDYSYRKTLNLLRDFV
LNSTHKPLVLFRTTTPDHFENGEWNTGGYCNRTMPFKEGQANMKTVDDVMRDVELEVFQK
FGKGFGLGSNIRLLDTTGMSLLRPDGHPGPYRHPNPFAGVKNKSNVQNDCLHWCLPGPID
SWNDVMVETTLNRERELYDLTG

Other information
Ka divergence:0.201668KaKs divergence:0.355157
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1371Length 2 (bp):1329Length divergence:-0.016
MFE 1 (kcal):-379.31MFE 2 (kcal):-365.32MFE divergence-0.019