Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01520-AT4G01280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.68332153857909
Log2 mRNA fold difference:0.48429714695563
Log2 TE fold difference:0.19609526352286
Sequences
Protein sequence

MVTVNPSQAHCLPMKMSLPGFNTLPHTATTIPVSIRSNRTMSFFEDPTKKVRKPYTITKS
RENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQKYFLKVQKNGTKEHLPP
PRPKRKANHPYPQKAPKFTLSSSNALFQHDYLYNTNSHPVISTTRKHGLVHCDVSIPSSV
IKEEFGVSENCCSTSSSRDKQRTRIVTETNDQESCGKPHRVAPNFAEVYNFIGSVFDPKT
TGHVKRLKEMDPINLETVLLLMKNLSVNLTSPEFDEQRKLISSYNAS

MVSVNPRPKGFPVFDSSNMSLPSSDGFGSIPATGRTSTVSFSEDPTTKIRKPYTIKKSRE
NWTDQEHDKFLEALHLFDRDWKKIEAFVGSKTVVQIRSHAQKYFLKVQKSGANEHLPPPR
PKRKASHPYPIKAPKNVAYTSLPSSSTLPLLEPGYLYSSDSKSLMGNQAVCASTSSSWNH
ESTNLPKPVIEVEEPGVSATAPLPNNRCRQEDTERVRAVTKPNNEESCEKPHRVMPNFAE
VYSFIGSVFDPNTSGHLQRLKQMDPINMETVLLLMQNLSVNLTSPEFAEQRRLISSYSAK
ALK

www.000webhost.com

Other information
Ka divergence:0.0337065KaKs divergence:0.301232
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):864Length 2 (bp):912Length divergence:0.027
MFE 1 (kcal):-225.01MFE 2 (kcal):-266.91MFE divergence0.085