Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01560-AT4G01370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MAP kinase 11
Function (paralog2):MAP kinase 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.7410324638973
Log2 mRNA fold difference:5.7952969723937
Log2 TE fold difference:-0.94483819589447
Sequences
Protein sequence

MSIEKPFFGDDSNRGVSINGGRYVQYNVYGNLFEVSKKYVPPLRPIGRGASGIVCAAWNS
ETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIIDIIRPPQPDNFNDVHIV
YELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDL
KIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTREPL
FPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSVNAV
DLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNEEPVCVRPFHFDFEQPSLTEENIKELI
YRESVKFNP

MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAA
TNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDV
YIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNAN
CDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTR
EPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSA
GAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIK
ELIYRETVKFNPQDSV

www.000webhost.com

Other information
Ka divergence:-0.495907KaKs divergence:-0.363958
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1110Length 2 (bp):1131Length divergence:0.009
MFE 1 (kcal):-310.63MFE 2 (kcal):-340.54MFE divergence0.046